DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoxb2a and unpg

DIOPT Version :9

Sequence 1:NP_571191.1 Gene:hoxb2a / 30338 ZFINID:ZDB-GENE-990415-103 Length:390 Species:Danio rerio
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:206 Identity:63/206 - (30%)
Similarity:86/206 - (41%) Gaps:48/206 - (23%)


- Green bases have known domain annotations that are detailed below.


Zfish    62 ARPRSQKRTASNGLQLRTQTAPPTQHQQGPAPLSGGAPLA--------HEFPWMKEKKSSKKCPK 118
            |..|..:..|:.|:....:..||..| ..||.....:|:.        .:|          :|..
  Fly   200 AAGRMHEDQANPGMAQLQEPTPPQAH-SSPAKSGSHSPMEPALDVGMDEDF----------ECSG 253

Zfish   119 PGATAAAAAASP--------SQASSGYTTAGLESPTEIQG------------------GLDNVSG 157
            ...:..:...||        ...:..||.:..|..::.:|                  |..:.|.
  Fly   254 DSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSK 318

Zfish   158 SRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKR---QTTH 219
            |||.|||:|:.||||||:|||..|||....|.:||..|.|:|.|||:||||||.|.||   ..|.
  Fly   319 SRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTS 383

Zfish   220 HRDGQEGEPSG 230
            |..|:.|..||
  Fly   384 HGLGRNGTTSG 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoxb2aNP_571191.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..73 3/10 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..100 5/18 (28%)
Antp-type hexapeptide 103..108 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..155 8/72 (11%)
Homeobox 162..214 CDD:278475 32/51 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..338 9/23 (39%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/50 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.