Sequence 1: | NP_571191.1 | Gene: | hoxb2a / 30338 | ZFINID: | ZDB-GENE-990415-103 | Length: | 390 | Species: | Danio rerio |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_477146.1 | Gene: | unpg / 35942 | FlyBaseID: | FBgn0015561 | Length: | 485 | Species: | Drosophila melanogaster |
Alignment Length: | 206 | Identity: | 63/206 - (30%) |
---|---|---|---|
Similarity: | 86/206 - (41%) | Gaps: | 48/206 - (23%) |
- Green bases have known domain annotations that are detailed below.
Zfish 62 ARPRSQKRTASNGLQLRTQTAPPTQHQQGPAPLSGGAPLA--------HEFPWMKEKKSSKKCPK 118
Zfish 119 PGATAAAAAASP--------SQASSGYTTAGLESPTEIQG------------------GLDNVSG 157
Zfish 158 SRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKR---QTTH 219
Zfish 220 HRDGQEGEPSG 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
hoxb2a | NP_571191.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 40..73 | 3/10 (30%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 81..100 | 5/18 (28%) | |||
Antp-type hexapeptide | 103..108 | 1/4 (25%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 108..155 | 8/72 (11%) | |||
Homeobox | 162..214 | CDD:278475 | 32/51 (63%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 211..338 | 9/23 (39%) | |||
unpg | NP_477146.1 | Homeobox | 324..375 | CDD:278475 | 31/50 (62%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |