DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoxd4a and Antp

DIOPT Version :9

Sequence 1:NP_001119917.1 Gene:hoxd4a / 30329 ZFINID:ZDB-GENE-980526-214 Length:256 Species:Danio rerio
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:247 Identity:93/247 - (37%)
Similarity:112/247 - (45%) Gaps:66/247 - (26%)


- Green bases have known domain annotations that are detailed below.


Zfish     2 EGGKKDNSRKISISYLQKLMAMSSYMVNSK----YVDPKFPPCEEYSQNSY----IPEQS--PGY 56
            |||......::|..::...|.:..:|.:.:    |.|...|...|..||.:    ..:||  |..
  Fly   176 EGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPV 240

Zfish    57 YSPSQDTDFQHPGIYSRSNYSEQPYSCSTVQGSSVQPRGHVQDQASTPSPFPAQTEQCPAVQISG 121
            .:|.|  ...|.|                 ||.....:|| ..|.:.||       |.|..|.||
  Fly   241 GAPPQ--GMMHQG-----------------QGPPQMHQGH-PGQHTPPS-------QNPNSQSSG 278

Zfish   122 SRTGGQQQNTKTQNGIPTKQPAVVYPWMKKVHVTTVNPDYTGPEPKRSRTAYTRQQVLELEKEFH 186
                               .|:.:||||:......       .|.||.|..|||.|.||||||||
  Fly   279 -------------------MPSPLYPWMRSQFGKC-------QERKRGRQTYTRYQTLELEKEFH 317

Zfish   187 FNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSASVG 238
            |||||||||||||||.|||:|||||||||||||||||::|   |||...|.|
  Fly   318 FNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENK---TKGEPGSGG 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoxd4aNP_001119917.1 Homeobox 169..222 CDD:278475 45/52 (87%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 41/182 (23%)
Homeobox 301..354 CDD:395001 46/52 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.