DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoxd4a and ftz

DIOPT Version :9

Sequence 1:NP_001119917.1 Gene:hoxd4a / 30329 ZFINID:ZDB-GENE-980526-214 Length:256 Species:Danio rerio
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:228 Identity:78/228 - (34%)
Similarity:107/228 - (46%) Gaps:49/228 - (21%)


- Green bases have known domain annotations that are detailed below.


Zfish    13 SISYLQKLMAMSSYMVNSKYVDPKFPPCEEYSQNSYIPEQSPGYYSPSQDTDFQHPGIYSRSNYS 77
            ::..::|..|:|:.:..|        |...|.| .|:...:|   |.|:|.|:       ...||
  Fly   130 TVEQVKKAPAVSTKVTAS--------PAPSYDQ-EYVTVPTP---SASEDVDY-------LDVYS 175

Zfish    78 EQPYSCSTVQGSSVQPRGHVQDQASTPSPFPAQTEQCPAVQISGSRTGGQQQNTKTQNGIPTK-- 140
            .|..:.....|....|      ..:||:..|         .:.|..|..|....|:.:.:..:  
  Fly   176 PQSQTQKLKNGDFATP------PPTTPTSLP---------PLEGISTPPQSPGEKSSSAVSQEIN 225

Zfish   141 -------QPAVVYPWMKKVHV-TTVNPDYTGPEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRI 197
                   ..|..:.|.   |: .|:..|.  .:.||:|..|||.|.||||||||||||:||||||
  Fly   226 HRIVTAPNGAGDFNWS---HIEETLASDC--KDSKRTRQTYTRYQTLELEKEFHFNRYITRRRRI 285

Zfish   198 EIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNT 230
            :||:.|.||||||||||||||||.|||..|.::
  Fly   286 DIANALSLSERQIKIWFQNRRMKSKKDRTLDSS 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoxd4aNP_001119917.1 Homeobox 169..222 CDD:278475 42/52 (81%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 29/154 (19%)
Homeobox 257..310 CDD:278475 42/52 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.