DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoxd4a and unpg

DIOPT Version :9

Sequence 1:NP_001119917.1 Gene:hoxd4a / 30329 ZFINID:ZDB-GENE-980526-214 Length:256 Species:Danio rerio
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:227 Identity:65/227 - (28%)
Similarity:96/227 - (42%) Gaps:71/227 - (31%)


- Green bases have known domain annotations that are detailed below.


Zfish    50 PEQSPGYYSPSQ-------DTDFQHPGIYSRSNYSEQPYSCSTVQGSSVQPRGH--VQDQASTPS 105
            |.:| |.:||.:       |.||:..|           .|||.: ..::.||.:  ..|::...:
  Fly   228 PAKS-GSHSPMEPALDVGMDEDFECSG-----------DSCSDI-SLTMSPRNYNGEMDKSRNGA 279

Zfish   106 PFPAQTEQCPAVQISGSRTGGQQQNTKTQNGIPTKQPAVVYPWMKKVHVTTVNPDYTGPEPKRSR 170
            ...:.:|.|...:.:.||..|.....|...|                     |...:..:.:|.|
  Fly   280 YTNSDSEDCSDDEGAQSRHEGGGMGGKDSQG---------------------NGSSSNSKSRRRR 323

Zfish   171 TAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKK------DHKLPN 229
            ||:|.:|:||||:|||..:||:...|.:||.:|.|||.|:||||||||.|||:      .|.|  
  Fly   324 TAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGL-- 386

Zfish   230 TKGRSA------------------SVGNQHAQ 243
              ||:.                  :|.:||.|
  Fly   387 --GRNGTTSGTKIVVPIPVHVNRFAVRSQHQQ 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoxd4aNP_001119917.1 Homeobox 169..222 CDD:278475 31/52 (60%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 30/50 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.