DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoxa2b and Antp

DIOPT Version :9

Sequence 1:NP_571181.1 Gene:hoxa2b / 30325 ZFINID:ZDB-GENE-990415-98 Length:363 Species:Danio rerio
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:194 Identity:71/194 - (36%)
Similarity:90/194 - (46%) Gaps:66/194 - (34%)


- Green bases have known domain annotations that are detailed below.


Zfish    26 PPVGDAFQSSSIKSSTLSHSTLIPPPFEQTIPSLNPGSHP-RHSRPKQNPNGSCPLPAASLP-PE 88
            ||||...|.       :.|....||...|        .|| :|:.|.||||..    ::.:| |.
  Fly   238 PPVGAPPQG-------MMHQGQGPPQMHQ--------GHPGQHTPPSQNPNSQ----SSGMPSPL 283

Zfish    89 YPWMKEK--KASKKNQTTSTAATTDPGPLYFSPQGSPEISDGGSGATRRLRTAYTNTQLLELEKE 151
            ||||:.:  |..::                                 :|.|..||..|.||||||
  Fly   284 YPWMRSQFGKCQER---------------------------------KRGRQTYTRYQTLELEKE 315

Zfish   152 FHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENHHGDGKPPSLEEAGGRGD 215
            ||||:||.|.||:|||..|.|||||:|:||||||||.|::.:.|      |:|.|    ||.||
  Fly   316 FHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTK------GEPGS----GGEGD 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoxa2bNP_571181.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..132 19/93 (20%)
Antp-type hexapeptide 88..93 3/4 (75%)
Homeobox 137..189 CDD:278475 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..218 11/30 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..279
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 27/119 (23%)
Homeobox 301..354 CDD:395001 37/52 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.