DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoxa2b and zen2

DIOPT Version :9

Sequence 1:NP_571181.1 Gene:hoxa2b / 30325 ZFINID:ZDB-GENE-990415-98 Length:363 Species:Danio rerio
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:257 Identity:77/257 - (29%)
Similarity:105/257 - (40%) Gaps:59/257 - (22%)


- Green bases have known domain annotations that are detailed below.


Zfish   120 QGSPEISDGGSGATRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNR 184
            :.:|..:...|..::|.|||:::.||:|||:|||.||||.|.||:||:..|.|||||||:|||||
  Fly    30 EAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNR 94

Zfish   185 RMKHKRQTQCKENHHGDGKPPSLEEAGGRGDGKSFFEQVANNVSGALLEREGYPFQQNTLTSQQS 249
            |||.|:.|..|      |...:|..:.......|...|..:.:...||...    ..|..|:...
  Fly    95 RMKLKKSTNRK------GAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYA----NTNVETAPLR 149

Zfish   250 QNGHNSDSQSATVSPLGSNDKHLKHF-PNP----------------------SPTVPICTTTMAP 291
            |..|....:.....|..|.| :|..| |.|                      .||:||....:. 
  Fly   150 QVDHGVLEEGQITPPYQSYD-YLHEFSPEPMALPQLPFNEFDANWASSWLGLEPTIPIAENVIE- 212

Zfish   292 DCASAQDNGSPSALDVSLQDFNVFSNDSCLHLSDAVSPSLSESVDSPIGLTTEAFDFFSETL 353
              .:.||       ...:|:|...||.|....||.:      .||         :||....|
  Fly   213 --HNTQD-------QPMIQNFCWDSNSSSASSSDIL------DVD---------YDFIQNLL 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoxa2bNP_571181.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..132 2/11 (18%)
Antp-type hexapeptide 88..93
Homeobox 137..189 CDD:278475 36/51 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..218 7/31 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..279 10/56 (18%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 36/52 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.