Sequence 1: | NP_571181.1 | Gene: | hoxa2b / 30325 | ZFINID: | ZDB-GENE-990415-98 | Length: | 363 | Species: | Danio rerio |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_477146.1 | Gene: | unpg / 35942 | FlyBaseID: | FBgn0015561 | Length: | 485 | Species: | Drosophila melanogaster |
Alignment Length: | 205 | Identity: | 62/205 - (30%) |
---|---|---|---|
Similarity: | 90/205 - (43%) | Gaps: | 40/205 - (19%) |
- Green bases have known domain annotations that are detailed below.
Zfish 14 SQPSLAECLTSFPPVGDAFQSSSIKSSTLSHSTLIPPPFEQTIPSLNPGSHPRHSRPKQNPNGSC 78
Zfish 79 -PLPAASLPPEYPWMKEKKASKKNQTTSTAATTDPGPLYFSPQGSPEISDGG------------- 129
Zfish 130 -SGATRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQ 193
Zfish 194 CKENHHGDGK 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
hoxa2b | NP_571181.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 42..132 | 17/104 (16%) | |
Antp-type hexapeptide | 88..93 | 1/4 (25%) | |||
Homeobox | 137..189 | CDD:278475 | 32/51 (63%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 186..218 | 6/18 (33%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 245..279 | ||||
unpg | NP_477146.1 | Homeobox | 324..375 | CDD:278475 | 31/50 (62%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |