DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnt10b and Wnt5

DIOPT Version :9

Sequence 1:NP_835737.1 Gene:wnt10b / 30308 ZFINID:ZDB-GENE-980526-524 Length:427 Species:Danio rerio
Sequence 2:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster


Alignment Length:552 Identity:131/552 - (23%)
Similarity:180/552 - (32%) Gaps:256/552 - (46%)


- Green bases have known domain annotations that are detailed below.


Zfish    42 LTPNAVCLRLAGLTKKQMRLCVRSPDVTASALQGIQVAIHECQHQLRDQRWNCSSLENH---GKL 103
            |.||. |....||:..|.:.||:...|..:..:|.:.||.|||.|.:::|||||:..:.   |.:
  Fly   543 LNPNN-CYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTNDETVFGPM 606

Zfish   104 PHQSAILNRGFRESAFSLSLLAAGVVHSVASACSLGKLRGCGCEAKRRLDDDKIRLKLTQLQLQT 168
            ...:|      .|.||..:|.||.|...:|.||..|:|..|.|.                     
  Fly   607 TSLAA------PEMAFIHALAAATVTSFIARACRDGQLASCSCS--------------------- 644

Zfish   169 FQRSGVSLAGAGENTPELSSLHGSLPANLHSSHPMSLLKPLPDEVTMLQDTWEWGGCSHDIRFGV 233
                                 .||.|..||                   |.|:||||..::.|..
  Fly   645 ---------------------RGSRPKQLH-------------------DDWKWGGCGDNLEFAY 669

Zfish   234 RFSRDWLDSR------------------------------------------------------- 243
            :|:.|::|||                                                       
  Fly   670 KFATDFIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVR 734

Zfish   244 ----------------------------------------------------------------- 243
                                                                             
  Fly   735 KSTEAENSHILNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRK 799

Zfish   244 -------------GSPRD------------------IHART--RIHNNRVGRQVVTDNMRRKCKC 275
                         ..||:                  :.||:  .:|||..||:.|....|..|||
  Fly   800 KKRKNQRAAADAPAYPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEAGRRAVIKKARITCKC 864

Zfish   276 HGTSGSCQFKTCWYVSPEFRLVGSLLREKF--LTAIFINSQNKNNGVFNSRTGGSTGSDPLRG-- 336
            ||.||||...|||......|.:|..||||:  .|.:.||.                     ||  
  Fly   865 HGVSGSCSLITCWQQLSSIREIGDYLREKYEGATKVKINK---------------------RGRL 908

Zfish   337 -----QRRRSISRELVYFEKSPDFCDREPAVDSLGTQGRICNKSSPGMDGCGSLCCGRGHNILKQ 396
                 |.:...:.:|:|.::|||:|....|:...||.||:|:|:|.|::.|..||||||:|....
  Fly   909 QIKDLQFKVPTAHDLIYLDESPDWCRNSYALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTKNI 973

Zfish   397 ARSERCHCRFHWCCYVLCEEC-KVTEWVNVCK 427
            ..:|||:|:|||||.|.||.| ||.| .:.||
  Fly   974 IVNERCNCKFHWCCQVKCEVCTKVLE-EHTCK 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wnt10bNP_835737.1 wnt 50..427 CDD:306592 125/542 (23%)
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 124/538 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586755
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.