DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Thg1l and THG

DIOPT Version :9

Sequence 1:NP_001013988.1 Gene:Thg1l / 303067 RGDID:1359513 Length:298 Species:Rattus norvegicus
Sequence 2:NP_001188815.1 Gene:THG / 34876 FlyBaseID:FBgn0283659 Length:286 Species:Drosophila melanogaster


Alignment Length:265 Identity:150/265 - (56%)
Similarity:188/265 - (70%) Gaps:19/265 - (7%)


- Green bases have known domain annotations that are detailed below.


  Rat    30 MAKSKFEYVRDFEVDDTCLPHCWVVVRLDGRNFHRFAEKHNFAKPNDSRALHLMTKCAQTVMQEL 94
            ||.|:||||:.||.||:.||:.|:|:|:||:.||:|::.|:|.||||..||::|...|..||||.
  Fly     1 MACSRFEYVKSFEQDDSILPNVWIVIRIDGKKFHKFSKTHDFEKPNDENALNVMNAAATAVMQEF 65

  Rat    95 EDIVIAYGQSDEYSFVFRKRSNWFKRRASKFMTLVASQFASSYVFYWRDYFEDQPLLYPPGFDGR 159
            .|||:||||||||||||||.:..||||::|.:|.|.|.|:||||..|..:. :.||.|.|.||||
  Fly    66 RDIVLAYGQSDEYSFVFRKETAAFKRRSAKLLTYVTSLFSSSYVMQWSKWM-NLPLAYAPCFDGR 129

  Rat   160 VVLYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQQRLKGTLTADKNEILFSEF 224
            ||||||.|.|||||||||||.|:||||||.||.|:.:.|||..||:.:|:||.:|||||:||.||
  Fly   130 VVLYPSEQNLKDYLSWRQADVHVNNLYNTAFWKLVLEKGLTNQQAEAKLRGTFSADKNELLFQEF 194

  Rat   225 HINYNNEPHMYRKGTVLVWQKVNEVRTQEIRLPAEMEGEKMAVTRTRTKLVALNCDLIGDAFWKE 289
            .|||||.|.||||||:|:.::|             :.|||     :|..:|.|:.|||...||||
  Fly   195 GINYNNLPAMYRKGTILLRKRV-------------ILGEK-----SRQAVVPLHEDLISSQFWKE 241

  Rat   290 HPEIL 294
            |.|||
  Fly   242 HTEIL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Thg1lNP_001013988.1 Thg1 31..291 CDD:226508 145/259 (56%)
THGNP_001188815.1 Thg1 2..239 CDD:226508 141/255 (55%)
Thg1 9..134 CDD:282322 71/125 (57%)
Thg1C 137..234 CDD:291110 60/114 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353451
Domainoid 1 1.000 164 1.000 Domainoid score I3868
eggNOG 1 0.900 - - E1_COG4021
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5959
Inparanoid 1 1.050 301 1.000 Inparanoid score I2603
OMA 1 1.010 - - QHG54375
OrthoDB 1 1.010 - - D1152974at2759
OrthoFinder 1 1.000 - - FOG0004478
OrthoInspector 1 1.000 - - oto95651
orthoMCL 1 0.900 - - OOG6_103009
Panther 1 1.100 - - LDO PTHR12729
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3173
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.