DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atoh1a and twi

DIOPT Version :9

Sequence 1:NP_571166.2 Gene:atoh1a / 30303 ZFINID:ZDB-GENE-990415-17 Length:292 Species:Danio rerio
Sequence 2:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster


Alignment Length:207 Identity:65/207 - (31%)
Similarity:86/207 - (41%) Gaps:49/207 - (23%)


- Green bases have known domain annotations that are detailed below.


Zfish    18 HSSLGRGEQSEYPPALALMASSDPRAWLAPVQAGTCAAHAEYLLHSPGSSAEGVSSASN-FRKSS 81
            :||..| :..||....||.:.||..   ..|.:..|.|..    .|.||..:|..:... |||..
  Fly   288 YSSSDR-DDMEYARHNALSSVSDLN---GGVMSPACLADD----GSAGSLLDGSDAGGKAFRKPR 344

Zfish    82 KSPVKVRELCRLKGAVGADEGRQRAPS-SKSTNVVQKQRRMAANARERRRMHGLNHAFDELRSVI 145
            :         |||          |.|| ::.|:....||.| ||.|||:|...||.||..|:.:|
  Fly   345 R---------RLK----------RKPSKTEETDEFSNQRVM-ANVRERQRTQSLNDAFKSLQQII 389

Zfish   146 PAFDNDKKLSKYETLQMAQIYINALSDLL-------------QG-PGAKADPPNCDLLHANVLET 196
            |...:| ||||.:||::|..||:.|..:|             || |.|.....:.....||..|.
  Fly   390 PTLPSD-KLSKIQTLKLATRYIDFLCRMLSSSDISLLKALEAQGSPSAYGSASSLLSAAANGAEA 453

Zfish   197 D----RSPRGSP 204
            |    |...|:|
  Fly   454 DLKCLRKANGAP 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoh1aNP_571166.2 HLH 117..175 CDD:238036 28/70 (40%)
twiNP_001033967.1 HLH 363..413 CDD:278439 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.