DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atoh1a and dimm

DIOPT Version :9

Sequence 1:NP_571166.2 Gene:atoh1a / 30303 ZFINID:ZDB-GENE-990415-17 Length:292 Species:Danio rerio
Sequence 2:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster


Alignment Length:269 Identity:70/269 - (26%)
Similarity:105/269 - (39%) Gaps:47/269 - (17%)


- Green bases have known domain annotations that are detailed below.


Zfish    19 SSLGRGEQSE--YPPALALMASSDP--RAWLAPVQAGTCAAHAEYLLHSPGSSAEGVSSASNFRK 79
            ||.|.|..:.  :|...:| ....|  |..:....:|.|.:..     :|.|::...|:|:.  .
  Fly    84 SSNGGGSTTNTGHPSGCSL-GGQGPSGRGRVQQASSGACPSTI-----APNSTSSNSSNANG--N 140

Zfish    80 SSKSPVKVRELCRLKGAVGADEGRQRAPSSKSTNVVQKQRRMAANARERRRMHGLNHAFDELRSV 144
            :|:         |.|||:.|.|              :..||:.:|.|||.|||.||.||..||.|
  Fly   141 ASR---------RRKGALNAKE--------------RNMRRLESNERERMRMHSLNDAFQSLREV 182

Zfish   145 IPAFDNDKKLSKYETLQMAQIYINALSDLL---QGPGAKADPPNCDLLHANVLETDRSPRGSPGV 206
            ||..:.:::|||.|||.:|:.||..|:.::   :...|.|...|...:...:|....|..|.|  
  Fly   183 IPHVEMERRLSKIETLTLAKNYIINLTHIILSKRNEEAAALELNSGAVGGVLLSNLSSESGGP-- 245

Zfish   207 CRRGTGVGYPYQYEDGTFNSFMEQDLQSPSGTSKSGSEASKDSPRSNRSDGEFSPHSHFSDSDET 271
                ...|.|......|   ...:|..:..|.......|:.|....|.:....||......|...
  Fly   246 ----VASGIPANSNAAT---ICFEDTLASGGAFDCAILAATDGSLLNAATVTTSPAMQSIQSQAI 303

Zfish   272 HLELQSEDE 280
            ||:...|.:
  Fly   304 HLQTPMEQQ 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoh1aNP_571166.2 HLH 117..175 CDD:238036 28/60 (47%)
dimmNP_001260674.1 HLH 154..208 CDD:238036 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.