DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atoh1a and CG33557

DIOPT Version :9

Sequence 1:NP_571166.2 Gene:atoh1a / 30303 ZFINID:ZDB-GENE-990415-17 Length:292 Species:Danio rerio
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:168 Identity:46/168 - (27%)
Similarity:74/168 - (44%) Gaps:40/168 - (23%)


- Green bases have known domain annotations that are detailed below.


Zfish    50 AGTCAAHAEYLL--HSPGSSAEGVSSASNFRKSSKSPVKVRELCRLKGAVGADE----GRQRAPS 108
            :.:.::.:.||:  .:..|::.|.:|.|                   ||....|    |::..|.
  Fly     4 SSSSSSFSNYLMAVFAQDSNSSGSASGS-------------------GAAADSEDSQIGQEANPG 49

Zfish   109 SKSTNVVQKQR--RMAANARERRRMHGLNHAFDELRSVIPAFDNDKKLSKYETLQMAQIYINALS 171
            .:......::|  |...|||||.|...:|.|::.||::||....::||||.|.:::|..||..||
  Fly    50 GQENQGNHRRRPPRQKINARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLS 114

Zfish   172 DLLQGPGAKADPPNCDLLHANVLETDRSPRGSPGVCRR 209
            ..|: .|.:..|  | |||         ...|.|:.||
  Fly   115 STLE-TGTECQP--C-LLH---------KYESEGITRR 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atoh1aNP_571166.2 HLH 117..175 CDD:238036 24/59 (41%)
CG33557NP_001014730.1 HLH 67..119 CDD:197674 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.