DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment her4.5 and E(spl)m5-HLH

DIOPT Version :9

Sequence 1:NP_571165.3 Gene:her4.5 / 30301 ZFINID:ZDB-GENE-081031-106 Length:152 Species:Danio rerio
Sequence 2:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster


Alignment Length:184 Identity:54/184 - (29%)
Similarity:79/184 - (42%) Gaps:38/184 - (20%)


- Green bases have known domain annotations that are detailed below.


Zfish     1 MAPTITGS---ISSRETLLTNKLRKPMVEKIRRERINSSIEKLKTLLAQEFVKQQPDSRQEKADI 62
            |||....|   :|..:..|  |::||::|:.||.|:|..::.||||:| ||.......|.:||::
  Fly     1 MAPQSNNSTTFVSKTQHYL--KVKKPLLERQRRARMNKCLDTLKTLVA-EFQGDDAILRMDKAEM 62

Zfish    63 LEMTLDFLRRSQKSSAAG------DGRSRCVQEAVSFLSQCPVQTQS------HTRLMKLFLHMQ 115
            ||..|.|:|:......|.      |........|||.:|:....|.:      .|.:..|.:..|
  Fly    63 LEAALVFMRKQVVKQQAPVSPLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEFQ 127

Zfish   116 --TPADQHTRVDNPQTTET-----------HANS----SAKQHTPAHSHIWRPW 152
              ..|||   |....||.|           |:::    ||....|....:||||
  Fly   128 RMLQADQ---VQTSVTTSTPRPLSPASSGYHSDNEDSQSAASPKPVEETMWRPW 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
her4.5NP_571165.3 HLH 19..75 CDD:238036 23/55 (42%)
ORANGE 77..123 CDD:128787 13/59 (22%)
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 22/52 (42%)
ORANGE 87..131 CDD:128787 9/43 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573752
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.