DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment her2 and E(spl)mbeta-HLH

DIOPT Version :9

Sequence 1:XP_005155978.1 Gene:her2 / 30300 ZFINID:ZDB-GENE-980526-274 Length:133 Species:Danio rerio
Sequence 2:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster


Alignment Length:181 Identity:46/181 - (25%)
Similarity:74/181 - (40%) Gaps:64/181 - (35%)


- Green bases have known domain annotations that are detailed below.


Zfish    17 KLRKPVVEKMRRDRINKCIEQLK-ILLKTEIKASQPCSKLEKADILEMAVIYLKN-TADAHARSY 79
            |:.||::|:.||.|||||:::|| |:::...:..:..::||||||||:.|.::|. .|....|..
  Fly    15 KVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLRAQKQLRLS 79

Zfish    80 SE------------AHAQSYADGYSRCIEETARFLSA-----------------HK----QTQKH 111
            |.            :.|:|:..||.....|.::.|:|                 |:    |....
  Fly    80 SVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRLNYLQVVVP 144

Zfish   112 SKPV---------DSCQIT------------------SEIAKHG--LWRPW 133
            |.|:         |...:|                  ||.:...  :||||
  Fly   145 SLPIGVPLQAPVEDQAMVTPPPSECDSLESGACSPAPSEASSTSGPMWRPW 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
her2XP_005155978.1 HLH 13..70 CDD:238036 23/53 (43%)
ORANGE 85..133 CDD:128787 16/97 (16%)
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 25/59 (42%)
ORANGE 97..141 CDD:128787 7/43 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573670
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.