DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment her3 and E(spl)m5-HLH

DIOPT Version :9

Sequence 1:NP_571155.1 Gene:her3 / 30289 ZFINID:ZDB-GENE-980526-204 Length:229 Species:Danio rerio
Sequence 2:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster


Alignment Length:232 Identity:53/232 - (22%)
Similarity:102/232 - (43%) Gaps:57/232 - (24%)


- Green bases have known domain annotations that are detailed below.


Zfish     1 MAAASNSAAT--AKPQNVKKVSKPLMEKKRRARINKCLNQLKSLLESACSNNIRKRKLEKADILE 63
            ||..||::.|  :|.|:..||.|||:|::||||:||||:.||:|:.....::...| ::||::||
  Fly     1 MAPQSNNSTTFVSKTQHYLKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAILR-MDKAEMLE 64

Zfish    64 LTVKHLRHLQNTKRGLSKACDSAEYHAGYRSCLNTVSHYLRASDT-DRDSRSIMLTNLTSGLNHN 127
            ..:..:|.....::..........:..||.:.::.:|..:..:.. ..|....::|:|  |:...
  Fly    65 AALVFMRKQVVKQQAPVSPLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHL--GVEFQ 127

Zfish   128 RVPDFSTVESDPALIFTLPSTLRRPHKVPIRTDVSYSSFQQTAERKVCLMPKRTEIGDSDRMSLD 192
            |:     :::|                 .::|.|:.|:            |:......|...|  
  Fly   128 RM-----LQAD-----------------QVQTSVTTST------------PRPLSPASSGYHS-- 156

Zfish   193 AALRSQESKKAETTHFRPKDLKVIECCIFKQNYWRPW 229
               .:::|:.|.:    ||.:        ::..||||
  Fly   157 ---DNEDSQSAAS----PKPV--------EETMWRPW 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
her3NP_571155.1 HLH 17..77 CDD:238036 23/59 (39%)
ORANGE 88..129 CDD:128787 7/41 (17%)
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 22/52 (42%)
ORANGE 87..131 CDD:128787 8/50 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573637
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.