DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment her6 and E(spl)m5-HLH

DIOPT Version :9

Sequence 1:NP_571154.2 Gene:her6 / 30288 ZFINID:ZDB-GENE-980526-144 Length:270 Species:Danio rerio
Sequence 2:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster


Alignment Length:256 Identity:52/256 - (20%)
Similarity:103/256 - (40%) Gaps:83/256 - (32%)


- Green bases have known domain annotations that are detailed below.


Zfish    18 PASMNTTPDKPKTASEHRKSSKPIMEKRRRARINESLGQLKTLILDALKKDSSRHSKLEKADILE 82
            |.|.|:|....|| ..:.|..||::|::||||:|:.|..||||:.:....|:.  .:::||::||
  Fly     3 PQSNNSTTFVSKT-QHYLKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAI--LRMDKAEMLE 64

Zfish    83 MTVKHLRNM---QRAQMTAALNTDPTVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLA 144
            ..:..:|..   |:|.::      |..:..::.|:...::|::|.::....::.:|...::.|| 
  Fly    65 AALVFMRKQVVKQQAPVS------PLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHL- 122

Zfish   145 SCMTQINAMNYPTQHQIPAGPPHPSFSQPMVQIPSATQQANVVPLSGVPCKSGSSSNLTSDATKV 209
                     ....|..:.|       .|....:.::|.:    |||                   
  Fly   123 ---------GVEFQRMLQA-------DQVQTSVTTSTPR----PLS------------------- 148

Zfish   210 YGGFQLVPATDGQFAFLIPNAAFAPNGPVIPVYANNSNTPVPVAVSPGAPSVTSDSVWRPW 270
                   ||:.|                   .:::|.::.     |..:|....:::||||
  Fly   149 -------PASSG-------------------YHSDNEDSQ-----SAASPKPVEETMWRPW 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
her6NP_571154.2 HLH 32..95 CDD:238036 21/65 (32%)
Hairy_orange 110..148 CDD:284859 6/37 (16%)
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 19/53 (36%)
ORANGE 87..131 CDD:128787 7/53 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573733
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.