DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment her5 and cwo

DIOPT Version :9

Sequence 1:NP_571152.1 Gene:her5 / 30285 ZFINID:ZDB-GENE-990415-90 Length:205 Species:Danio rerio
Sequence 2:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster


Alignment Length:219 Identity:48/219 - (21%)
Similarity:75/219 - (34%) Gaps:68/219 - (31%)


- Green bases have known domain annotations that are detailed below.


Zfish    13 LMEKRRRDRINQSLETLRMLLLENTNNEKLKNPKVEKAEILESVVHFLRAEQASETDPFQITRVK 77
            ::|||||||:|..|..|..|:  ....::....::||.||:|..:..|:                
  Fly    69 IIEKRRRDRMNSCLADLSRLI--PPQYQRKGRGRIEKTEIIEMAIRHLK---------------- 115

Zfish    78 RARTEESDEDVESPC--KRQSYHDGMRTCLLRVSNF------------ITGKSHEFGQELEK--- 125
                     .::|.|  |...|..|...|:...:.|            :.|:..|...|:.|   
  Fly   116 ---------HLQSECQQKESDYRSGYMDCMKEAAKFLYDVHMQDFCHRLLGRLQEHIDEMFKTDC 171

Zfish   126 -----AC---ENIHKS-------------HSRQVQLLSTPSLIEPQVHL-YEDPS-QQHLAHVQL 167
                 :|   :|:..|             |.|.:...|...:...|.|. .:|.| :.||..:|.
  Fly   172 YKSTRSCHMPDNVSASSGSPHQAYHPPLCHLRDMLATSASDVEHSQDHNDVKDLSFRNHLNQLQR 236

Zfish   168 SNSCTPSGCSKLAQRTVPAMTSSP 191
            |.....:.....|...| |..|||
  Fly   237 SQQAAAAAAVAAAAVAV-ANGSSP 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
her5NP_571152.1 HLH 4..67 CDD:238036 17/53 (32%)
cwoNP_524775.1 HLH 66..118 CDD:306515 17/75 (23%)
ORANGE 126..168 CDD:128787 7/41 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573838
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.