DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment her5 and E(spl)mbeta-HLH

DIOPT Version :9

Sequence 1:NP_571152.1 Gene:her5 / 30285 ZFINID:ZDB-GENE-990415-90 Length:205 Species:Danio rerio
Sequence 2:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster


Alignment Length:215 Identity:51/215 - (23%)
Similarity:91/215 - (42%) Gaps:49/215 - (22%)


- Green bases have known domain annotations that are detailed below.


Zfish     7 RRVPKPLMEKRRRDRINQSLETLRMLLLENTNNEKLKNPKVEKAEILESVVHFLRAEQASETDPF 71
            |:|.||::|::||.|||:.|:.|:.:::|....|.....::|||:|||..|..::..:|.:  ..
  Fly    14 RKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLRAQK--QL 76

Zfish    72 QITRVKRARTEESDEDVESPCKRQSYHDGMRTCLLRVSNFIT-------GKSHEFGQELEKACEN 129
            :::.|....:..:|       .:.|..:..|...:..:|.::       |.|.:.|.:|..    
  Fly    77 RLSSVTGGVSPSAD-------PKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMS---- 130

Zfish   130 IHKSHSRQVQLLSTPSL---------IEPQVHLYEDPSQQHLAHVQLSNSCTPSGCSKLAQRTVP 185
             |..|......:..|||         :|.|..:...||:.....   |.:|:|:          |
  Fly   131 -HLGHRLNYLQVVVPSLPIGVPLQAPVEDQAMVTPPPSECDSLE---SGACSPA----------P 181

Zfish   186 AMTSSPKQPVMLCDPVWRPW 205
            :..||..      .|:||||
  Fly   182 SEASSTS------GPMWRPW 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
her5NP_571152.1 HLH 4..67 CDD:238036 22/59 (37%)
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 22/62 (35%)
ORANGE 97..141 CDD:128787 8/48 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573707
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.