DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment her5 and h

DIOPT Version :9

Sequence 1:NP_571152.1 Gene:her5 / 30285 ZFINID:ZDB-GENE-990415-90 Length:205 Species:Danio rerio
Sequence 2:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster


Alignment Length:191 Identity:53/191 - (27%)
Similarity:83/191 - (43%) Gaps:47/191 - (24%)


- Green bases have known domain annotations that are detailed below.


Zfish     4 KDMRRVPKPLMEKRRRDRINQSLETLRMLLLENTNNEKLKNPKVEKAEILESVVHFLRAEQASET 68
            |..||..||:||||||.|||..|..|:.|:|:.|..:..::.|:|||:|||..|..|:       
  Fly    29 KSDRRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQ------- 86

Zfish    69 DPFQITRVKRARTEESDEDVESPCKRQSYHDGMRTCLLRVSNFITGKSHEFGQELEKACENIHKS 133
               ::.|.:.|..:.:|..:.:..|.     |...|:..||.|         ..:|.|      .
  Fly    87 ---ELQRQQAAMQQAADPKIVNKFKA-----GFADCVNEVSRF---------PGIEPA------Q 128

Zfish   134 HSRQVQLLST-PSLIEPQVHLYEDPSQQHLAHVQLSNSCTPSGCSKLAQRTVPAMTSSPKQ 193
            ..|.:|.||. .:.::.::|..:...||...|.|:                :|:..|||:|
  Fly   129 RRRLLQHLSNCINGVKTELHQQQRQQQQQSIHAQM----------------LPSPPSSPEQ 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
her5NP_571152.1 HLH 4..67 CDD:238036 28/62 (45%)
hNP_001014577.1 HLH 29..88 CDD:238036 28/68 (41%)
ORANGE 106..141 CDD:128787 12/54 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.