DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnt11 and Wnt10

DIOPT Version :9

Sequence 1:NP_571151.1 Gene:wnt11 / 30283 ZFINID:ZDB-GENE-980526-249 Length:352 Species:Danio rerio
Sequence 2:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster


Alignment Length:444 Identity:123/444 - (27%)
Similarity:194/444 - (43%) Gaps:118/444 - (26%)


- Green bases have known domain annotations that are detailed below.


Zfish    10 LCLLTFLLLSQQCTGIRWLALSQTAQHINKTQHCKTLPGLVSSQAQLCRSNLELMQTIIQAAREV 74
            |.|:..::|: .||  |||......:     ..|:::|||...|.:||....::....::.....
  Fly    51 LHLIVMIILA-CCT--RWLYGLPDGR-----ATCRSVPGLTKDQVELCYKASDVTAAALEGLDMA 107

Zfish    75 KKVCQKTFTDMRWNCSSID----GPKFLPDLERGTRESAFVYALSAAAISHTIARACTSGDLRLC 135
            .:.||..|...||||||:.    .|.....|::|.|||||.:|:|||.::|::||||:.|.|..|
  Fly   108 IRECQIQFQWHRWNCSSLSTKSRNPHASSLLKKGYRESAFAFAISAAGVAHSVARACSQGRLMSC 172

Zfish   136 SCGPI--------------------------PGEIPEP-------------GYRWGGCADNIHYG 161
            .|.|.                          ..:|..|             .::||||:.|:.:|
  Fly   173 GCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTPEEEKKYERSKIASRWKWGGCSHNMDFG 237

Zfish   162 LLMGSKFSDAPMKMKKKSGSHANKLMHLHNSEVGRQALRDALVMKCKCHGVSGSCSIRTCWRGLL 226
            :.....|.|.    ::|:|...:|: :|||:..||.|:.:.:..:|||||:||||.::|||:...
  Fly   238 VEYSKLFLDC----REKAGDIQSKI-NLHNNHAGRIAVSNNMEFRCKCHGMSGSCQLKTCWKSAP 297

Zfish   227 DLKDIAIDLKTKYLSATKVVHRPMGTRKQLV-------------------PKDID---------- 262
            |...:...||.::..|..|....:|..:.:|                   ..|:|          
  Fly   298 DFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNKKSNGGSGSGSTSPDLDSTDASGGHDD 362

Zfish   263 -----------------------------IRPVR--ENELVYLQSSPDYCMKNDKLGSFGTQDRQ 296
                                         .|..|  |..|.|.|.||::|.::......||..|:
  Fly   363 GGTGDSETRRHDELGVERGTRQPSADKNAARMARKLETSLFYYQRSPNFCERDLGADIQGTVGRK 427

Zfish   297 CNKTSSGSDSCDLMCCGRGYNPYTERVVERCHCKYHWCCYVTCKKCDKTVEKYV 350
            ||:.::.||.|..:|||||::...:|..||||||:.|||.|.|::|.  ||:::
  Fly   428 CNRNTTTSDGCTSLCCGRGHSQVIQRRAERCHCKFQWCCNVECEECH--VEEWI 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wnt11NP_571151.1 wnt 49..352 CDD:278536 112/405 (28%)
Wnt10NP_609109.3 wnt 82..466 CDD:278536 105/388 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586720
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.