DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ins and Ilp5

DIOPT Version :9

Sequence 1:NP_571131.1 Gene:ins / 30262 ZFINID:ZDB-GENE-980526-110 Length:108 Species:Danio rerio
Sequence 2:NP_996037.2 Gene:Ilp5 / 2768992 FlyBaseID:FBgn0044048 Length:108 Species:Drosophila melanogaster


Alignment Length:115 Identity:33/115 - (28%)
Similarity:47/115 - (40%) Gaps:32/115 - (27%)


- Green bases have known domain annotations that are detailed below.


Zfish    10 LLVLLVVSSVSTNPGTPQHLCGSHLVDALYLVCGPTGFFYNPKRDVEPLLGFLPPKSAQETEVAD 74
            :|:.|:...:|.........||..|:|.|.:.| |.||  |........||.             
  Fly     9 VLLFLIPLLLSAQAANSLRACGPALMDMLRVAC-PNGF--NSMFAKRGTLGL------------- 57

Zfish    75 FAFKDH-AEL-------------IRK--RGIVEQCCHKPCSIFELQNYCN 108
            |.::|| |:|             ||:  ||:|:.||.|.||...|:.||:
  Fly    58 FDYEDHLADLDSSESHHMNSLSSIRRDFRGVVDSCCRKSCSFSTLRAYCD 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
insNP_571131.1 IlGF_insulin_like 25..108 CDD:239833 29/98 (30%)
Ilp5NP_996037.2 IlGF_insulin_bombyxin_like 29..106 CDD:239832 28/92 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I5469
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1644517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.