DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neurog1 and twi

DIOPT Version :9

Sequence 1:NP_571116.1 Gene:neurog1 / 30239 ZFINID:ZDB-GENE-990415-174 Length:208 Species:Danio rerio
Sequence 2:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster


Alignment Length:189 Identity:52/189 - (27%)
Similarity:79/189 - (41%) Gaps:31/189 - (16%)


- Green bases have known domain annotations that are detailed below.


Zfish    16 SFSHTDDEDSRSSLHPA-SPASSCGKPPASPAGLQ-------------------QKKRRRGRARN 60
            ::|.:|.:|...:.|.| |..|.......|||.|.                   :|.|||.:.:.
  Fly   287 AYSSSDRDDMEYARHNALSSVSDLNGGVMSPACLADDGSAGSLLDGSDAGGKAFRKPRRRLKRKP 351

Zfish    61 ETTVHVVK-KNRRLKANDRERNRMHNLNDALDALRSVLPAFPDDTKLTKIETLRFAHNYIWALSE 124
            ..|....: .|:|:.||.|||.|..:||||..:|:.::|..|.| ||:||:||:.|..||..|..
  Fly   352 SKTEETDEFSNQRVMANVRERQRTQSLNDAFKSLQQIIPTLPSD-KLSKIQTLKLATRYIDFLCR 415

Zfish   125 TIRIADQKQGKSRDGPLLLPGLSCMADAPSPGSDSCSWPSGASSSSSSPSYCNSDPGSP 183
            .:..:|..         ||..|.......:.||.|....:.|:.:.:.........|:|
  Fly   416 MLSSSDIS---------LLKALEAQGSPSAYGSASSLLSAAANGAEADLKCLRKANGAP 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neurog1NP_571116.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 15/65 (23%)
CCDC106 <20..>102 CDD:292422 29/102 (28%)
HLH 68..127 CDD:238036 26/59 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..180 2/20 (10%)
twiNP_001033967.1 HLH 363..413 CDD:278439 24/50 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.