DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment en2b and Ptx1

DIOPT Version :9

Sequence 1:NP_571115.1 Gene:en2b / 30238 ZFINID:ZDB-GENE-980526-40 Length:261 Species:Danio rerio
Sequence 2:NP_001138130.2 Gene:Ptx1 / 43664 FlyBaseID:FBgn0020912 Length:610 Species:Drosophila melanogaster


Alignment Length:90 Identity:34/90 - (37%)
Similarity:51/90 - (56%) Gaps:5/90 - (5%)


- Green bases have known domain annotations that are detailed below.


Zfish   152 DRP--SSGPRSRKPKKKTPTKEDKRPRTAFTAEQLQRLKNEFQNNRYLTEQRRQALAQELGLNES 214
            |.|  :||   .:||.....|..:|.||.||::|||.|::.|..|||.....|:.:|....|.|:
  Fly   245 DEPMTTSG---EEPKNDKKNKRQRRQRTHFTSQQLQELEHTFSRNRYPDMSTREEIAMWTNLTEA 306

Zfish   215 QIKIWFQNKRAKIKKATGNKNTLAV 239
            ::::||:|:|||.:|...|....||
  Fly   307 RVRVWFKNRRAKWRKRERNAMNAAV 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
en2bNP_571115.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..125
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..176 8/25 (32%)
Homeobox 175..228 CDD:278475 22/52 (42%)
Engrail_1_C_sig 230..259 CDD:287495 3/10 (30%)
Ptx1NP_001138130.2 Homeobox 268..320 CDD:278475 22/51 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.