DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tnn and CG9500

DIOPT Version :9

Sequence 1:XP_005171321.1 Gene:tnn / 30234 ZFINID:ZDB-GENE-990415-262 Length:1020 Species:Danio rerio
Sequence 2:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster


Alignment Length:267 Identity:84/267 - (31%)
Similarity:132/267 - (49%) Gaps:21/267 - (7%)


- Green bases have known domain annotations that are detailed below.


Zfish   747 TARENRFALSGLEMGKKYIVTLIAYRGSKRS----KIVETTFSTVGLAYQFPMDCTQIMRNGNME 807
            ||..|:..|..|   .|.::.|:....|..|    :...:..:|.||:.::|..|...    ...
  Fly    30 TAIRNKPELKSL---YKLVLALLEENQSNASTENIQKSSSDLNTTGLSGRYPSQCPTY----PPA 87

Zfish   808 SGVYTIYVNNNRSRTMQVYCDMKTDGGGWIVFQRRNTGKVDFMKKWRDYMKGFGELTEEFWLGLD 872
            .|:||:.|..  .:..||.||.:..|.||.|..||.:.|::|.:.|.:|..|||:|..:|::|||
  Fly    88 HGIYTVQVLG--LKPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLD 150

Zfish   873 KIHELTNT-PTQYEARFDLGSGSDRKYAVYDNFKVAPSKQKFKLT-IGSYKGNAGDAMTYHQGAP 935
            |:|.:|.: |.:.....:...|..| ||.||...:....:.:.:| :|.:.|:|||:|.:::...
  Fly   151 KLHAITKSQPHELYIHLEDFEGQTR-YAHYDEIFIESENKFYAMTKLGEFTGDAGDSMIHNRNQN 214

Zfish   936 FSTVDSDNDIALGNCALTHQGAWWYKNCHLANLNGRF--GDNRHSM---GVNWEPWKGHLQSLDF 995
            |||.|.|||....|||..:.||||:.||..:||.|.:  ||.....   |:.|..|:....|...
  Fly   215 FSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQWKGIVWHSWRTESYSYKV 279

Zfish   996 AEIKIRP 1002
            .::.:||
  Fly   280 MQMMVRP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tnnXP_005171321.1 EGF_alliinase <133..163 CDD:282688
EGF_2 161..189 CDD:285248
EGF_2 193..220 CDD:285248
EGF_2 224..251 CDD:285248
fn3 257..333 CDD:278470
fn3 344..426 CDD:278470
fn3 435..514 CDD:278470
fn3 523..602 CDD:278470
fn3 611..683 CDD:278470
fn3 699..773 CDD:278470 7/25 (28%)
FReD 792..1003 CDD:238040 72/218 (33%)
CG9500NP_609018.3 FReD 76..287 CDD:238040 72/218 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.