DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inab and LamC

DIOPT Version :9

Sequence 1:NP_571107.2 Gene:inab / 30230 ZFINID:ZDB-GENE-990415-83 Length:469 Species:Danio rerio
Sequence 2:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster


Alignment Length:489 Identity:135/489 - (27%)
Similarity:221/489 - (45%) Gaps:105/489 - (21%)


- Green bases have known domain annotations that are detailed below.


Zfish    10 ASSYRKIFGDSTRFSASPSRLSSSRSGFKSQSVNRPNIPSSYKRSTRSGFPSSSLDSFDFTQSTV 74
            ||:...:.|.||          |||.|..|        |:|..|::|.                 
  Fly    15 ASTSTPVGGAST----------SSRVGATS--------PTSPTRTSRQ----------------- 44

Zfish    75 LNNEFKIIRTNEKEQMQGLNDRFAMFIEKVRNLEQHNKVLETELVTLRQR--QTEPSRLAELYQQ 137
                      .|||::|.||||.|.:|:::||||..|..|..|| .|.|.  ..|.|.|..:|::
  Fly    45 ----------QEKEELQHLNDRLACYIDRMRNLENENSRLTQEL-NLAQDTVNRETSNLKAVYEK 98

Zfish   138 EIRELRSQLEELNAEK-------NQMMFERDSIEEDLQK-------------LHE---------- 172
            |:...|..|:|...||       .::..|.|.::..|.|             |:|          
  Fly    99 ELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKY 163

Zfish   173 --------KFEEEMR----MREEAEQTLRAFKKDVDNASMVRLDLEKKVESLLDEINFLRKVHEE 225
                    |||::.:    ..|...:.|...:|.::..::.|:|||.:.:||.:|:.|..:||.:
  Fly   164 NQSLADRKKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQ 228

Zfish   226 EVAELMNMIQASQVSVEMEVAK---PDLTSALKDIRGQYEAMASKNLQSAEEWYKSKFADLSEQA 287
            |:.|..:..|.....::..:::   ..|..:|:::|.|||.....|.:..|..|.::..:|...|
  Fly   229 ELTETRSRRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAA 293

Zfish   288 NKSNEVIRASREELNEFRRQLQSKTIEIESLRGTNESLERQIHEMEDRHNAEIMGYQDSIGELEN 352
            |::.:....:.||:...|.::.....::::|..||..|..:|.|:|:..:.|...:...|..||.
  Fly   294 NRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEA 358

Zfish   353 DLRTTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRISTGITYP----TPASVSSYSY 413
            :|:..:.|||..|:|||.|:::|::||:|||||.|||.|||.|::  |..|    |.:.:||.. 
  Fly   359 ELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLN--IESPGRPTTDSGISSNG- 420

Zfish   414 QSRLYSSTSMSSKKEVKDDDDKQQSGKPG-KGSS 446
             |.|.:|.|..|.:.....   ::|..|| .|||
  Fly   421 -SHLTASASSRSGRVTPSG---RRSATPGISGSS 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inabNP_571107.2 Filament_head 8..84 CDD:282575 14/73 (19%)
Filament 85..395 CDD:278467 104/356 (29%)
LamCNP_001260974.1 Filament 45..401 CDD:278467 104/356 (29%)
ATP-synt_B <67..>142 CDD:304375 22/75 (29%)
MreC <178..>224 CDD:302802 11/45 (24%)
LTD 473..574 CDD:279300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.