DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H3-3B and His3:CG33848

DIOPT Version :10

Sequence 1:NP_005315.1 Gene:H3-3B / 3021 HGNCID:4765 Length:136 Species:Homo sapiens
Sequence 2:NP_001027358.1 Gene:His3:CG33848 / 3772619 FlyBaseID:FBgn0053848 Length:136 Species:Drosophila melanogaster


Alignment Length:136 Identity:132/136 - (97%)
Similarity:135/136 - (99%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            |||||||||||||||||||||||||||||||:|||||||||||||||||||||||||||||||||
  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65

Human    66 LPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            ||||||||||||||||||||||:|:.|||||||||||||||||||||||||||||||||||||||
  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130

Human   131 IRGERA 136
            ||||||
  Fly   131 IRGERA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H3-3BNP_005315.1 PTZ00018 1..136 CDD:185400 130/134 (97%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 40/41 (98%)
His3:CG33848NP_001027358.1 PTZ00018 1..136 CDD:185400 130/134 (97%)

Return to query results.
Submit another query.