DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H3-3B and His3.3A

DIOPT Version :9

Sequence 1:NP_005315.1 Gene:H3-3B / 3021 HGNCID:4765 Length:136 Species:Homo sapiens
Sequence 2:NP_001260082.1 Gene:His3.3A / 33736 FlyBaseID:FBgn0014857 Length:136 Species:Drosophila melanogaster


Alignment Length:136 Identity:136/136 - (100%)
Similarity:136/136 - (100%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65

Human    66 LPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 LPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130

Human   131 IRGERA 136
            ||||||
  Fly   131 IRGERA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H3-3BNP_005315.1 PTZ00018 1..136 CDD:185400 134/134 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 41/41 (100%)
His3.3ANP_001260082.1 PTZ00018 1..136 CDD:185400 134/134 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153885
Domainoid 1 1.000 257 1.000 Domainoid score I2023
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 265 1.000 Inparanoid score I3059
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54047
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000188
OrthoInspector 1 1.000 - - oto90732
orthoMCL 1 0.900 - - OOG6_100119
Panther 1 1.100 - - LDO PTHR11426
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X183
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.800

Return to query results.
Submit another query.