DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H3-3A and cid

DIOPT Version :9

Sequence 1:NP_001365972.1 Gene:H3-3A / 3020 HGNCID:4764 Length:136 Species:Homo sapiens
Sequence 2:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster


Alignment Length:177 Identity:52/177 - (29%)
Similarity:67/177 - (37%) Gaps:51/177 - (28%)


- Green bases have known domain annotations that are detailed below.


Human     3 RTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRY--------------------RPGTV 47
            |...|.|:..|.:.|       |||.|:.|.....:.:||                    ..|.|
  Fly    55 RRSSTLRRDAGRRQP-------AARDSSTSGEEEDQENRYPTTRSPQTRRMTVQQESKTRAAGPV 112

Human    48 AL--------------------REIRRYQKSTELLIRKLPFQRLVREIAQDFKTD--LRFQSAAI 90
            |.                    |||||.|.....||.||||.|||||....:..|  ||....|:
  Fly   113 AAQNQTRRRKAANPMSRAKRMDREIRRLQHHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGAL 177

Human    91 GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI--RGER 135
            .|:||:.|.||.....|:.:...|..|||:..:|:.|...|  ||.:
  Fly   178 LAMQESCEMYLTQRLADSYMLTKHRNRVTLEVRDMALMAYICDRGRQ 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H3-3ANP_001365972.1 PTZ00018 1..136 CDD:185400 52/177 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 12/59 (20%)
cidNP_523730.2 H4 135..219 CDD:419976 34/83 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.