DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twist1a and Fer3

DIOPT Version :9

Sequence 1:NP_571059.1 Gene:twist1a / 30175 ZFINID:ZDB-GENE-000210-6 Length:171 Species:Danio rerio
Sequence 2:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster


Alignment Length:91 Identity:36/91 - (39%)
Similarity:53/91 - (58%) Gaps:1/91 - (1%)


- Green bases have known domain annotations that are detailed below.


Zfish    53 PTPGKRSKKCSNSSSSPQSLEDLQTQRVMANVRERQRTQSLNEAFASLRKIIPTLPSDK-LSKIQ 116
            |:...|:...|:||...:.......||..||:|||:|..:|||||..||:.:||...:| ||:|:
  Fly    62 PSTNGRANGSSSSSKKTRRRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIE 126

Zfish   117 TLKLAARYIDFLCQVLQSDELDSKMS 142
            ||:||..||.|:.::|.....:|..|
  Fly   127 TLRLAITYIGFMAELLSGTPSNSHKS 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twist1aNP_571059.1 HLH 78..128 CDD:278439 27/50 (54%)
Fer3NP_524322.1 HLH 87..135 CDD:278439 25/47 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.