DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twist1a and CG33557

DIOPT Version :9

Sequence 1:NP_571059.1 Gene:twist1a / 30175 ZFINID:ZDB-GENE-000210-6 Length:171 Species:Danio rerio
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:127 Identity:38/127 - (29%)
Similarity:61/127 - (48%) Gaps:27/127 - (21%)


- Green bases have known domain annotations that are detailed below.


Zfish    47 AEDSDSPTPGKRSKKCSNSSSS-------PQSLED-----LQTQRVMANVRERQRTQSLNEAFAS 99
            |:||:|......|...::|..|       |...|:     .:..|...|.|||.||.::|.|:.:
  Fly    19 AQDSNSSGSASGSGAAADSEDSQIGQEANPGGQENQGNHRRRPPRQKINARERYRTFNVNSAYEA 83

Zfish   100 LRKIIPTLPSD-KLSKIQTLKLAARYIDFLCQVL--------------QSDELDSKMSSCSY 146
            ||.:|||.|.: |||||:.::||:.||..|...|              :|:.:..::|.|::
  Fly    84 LRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLETGTECQPCLLHKYESEGITRRISICTF 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twist1aNP_571059.1 HLH 78..128 CDD:278439 24/50 (48%)
CG33557NP_001014730.1 HLH 67..119 CDD:197674 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583741
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.