DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnt10a and wntD

DIOPT Version :9

Sequence 1:NP_571055.1 Gene:wnt10a / 30171 ZFINID:ZDB-GENE-990415-278 Length:442 Species:Danio rerio
Sequence 2:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster


Alignment Length:330 Identity:86/330 - (26%)
Similarity:134/330 - (40%) Gaps:82/330 - (24%)


- Green bases have known domain annotations that are detailed below.


Zfish   117 DVTASAIQGIQIAIHECQHQFRGHRWNCSSLE--TRNKIPYESVVFSRGFRESAFAYAIAAAGVV 179
            |:|.   :|::.|:..||..|:..||||.|.:  .:|..|.|    :...||..:..||:.|.:|
  Fly    38 DITG---KGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEE----NSPNREDVYVAAISMAAIV 95

Zfish   180 HAVSNACAMGKLKACGCDEKRRGDEEAFRIKLNRLQLEAINRGKGMVHGVMEHFPAEALGPQDSW 244
            |.::..||.|.:..|||.|             |.|.:..            .|.|.:||      
  Fly    96 HTLTKDCANGVIAGCGCTE-------------NALNVPC------------AHEPTKAL------ 129

Zfish   245 EWGGCSPNVEYGERFSKDFLDSRETYRDIHSRMRLHNNRVGRQVVVDHMRRKCKCH---GTSGSC 306
                        |::.|.|...        |....||.||...::...:.::|:|.   ...|.|
  Fly   130 ------------EQYEKHFGSG--------SGAIGHNRRVVGALLQRSLEQECRCKQPGAVQGEC 174

Zfish   307 QLKTCWQVTPEFRTVGSLLKERFNVATLIKAHNRNTGQVENAHHTHR---RRANINDLVYFEKSP 368
            |.:.|..|...|..:...|.:.::.|.          |:|.|....:   :...::.||:.:.||
  Fly   175 QEEECVAVLKPFEAIAQDLLQMYDDAI----------QLEGASSNLKIMWQNIPLDSLVFMQDSP 229

Zfish   369 DFCERDLGSDSAGTQGRICNKTSQG----MDNCESLCCGRGHNI-LQQTRSE-RCNCKFHWCCYV 427
            ::||||......||:||.|:|...|    ..:|:.||...|:.: .|..|:| |||||..|...:
  Fly   230 NYCERDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRL 294

Zfish   428 VCEEC 432
            .|:.|
  Fly   295 QCDVC 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wnt10aNP_571055.1 wnt 104..442 CDD:278536 86/330 (26%)
wntDNP_650272.1 wnt 41..308 CDD:302926 84/327 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.