DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnt10a and Wnt5

DIOPT Version :9

Sequence 1:NP_571055.1 Gene:wnt10a / 30171 ZFINID:ZDB-GENE-990415-278 Length:442 Species:Danio rerio
Sequence 2:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster


Alignment Length:508 Identity:135/508 - (26%)
Similarity:185/508 - (36%) Gaps:203/508 - (39%)


- Green bases have known domain annotations that are detailed below.


Zfish    92 LNANTVCLTLPGLTKKQLDVCMRNPDVTASAIQGIQIAIHECQHQFRGHRWNCSSLETRNKIPYE 156
            ||.|. |.:..||:..|...|:::..|..:..:|.:.||.|||.||:..|||||   |.|    :
  Fly   543 LNPNN-CYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCS---TTN----D 599

Zfish   157 SVVF----SRGFRESAFAYAIAAAGVVHAVSNACAMGKLKACGCDEKRRGDEEAFRIKLNRLQLE 217
            ..||    |....|.||.:|:|||.|...::.||..|:|.:|.|.   ||               
  Fly   600 ETVFGPMTSLAAPEMAFIHALAAATVTSFIARACRDGQLASCSCS---RG--------------- 646

Zfish   218 AINRGKGMVHGVMEHFPAEALGPQDSWEWGGCSPNVEYGERFSKDFLDSR--------------- 267
              :|.|.:               .|.|:||||..|:|:..:|:.||:|||               
  Fly   647 --SRPKQL---------------HDDWKWGGCGDNLEFAYKFATDFIDSREKETNRETRGVKRKR 694

Zfish   268 ----------------------------------------------------------------- 267
                                                                             
  Fly   695 EEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRKSTEAENSHILNENFDQHLLELEQR 759

Zfish   268 -------------------------------------------------------------ETYR 271
                                                                         |:|:
  Fly   760 ITKEILTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKKKRKNQRAAADAPAYPRNGIKESYK 824

Zfish   272 D------------IHSRMRLHNNRVGRQVVVDHMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGSL 324
            |            ..|.|.||||..||:.|:...|..|||||.||||.|.||||.....|.:|..
  Fly   825 DGGILPRSTATVKARSLMNLHNNEAGRRAVIKKARITCKCHGVSGSCSLITCWQQLSSIREIGDY 889

Zfish   325 LKERFNVATLIKAHNRNTGQVENAHHTHRRRANINDLVYFEKSPDFCERDLGSDSAGTQGRICNK 389
            |:|::..||.:|.:.|...|:::...   :....:||:|.::|||:|.........||.||:|:|
  Fly   890 LREKYEGATKVKINKRGRLQIKDLQF---KVPTAHDLIYLDESPDWCRNSYALHWPGTHGRVCHK 951

Zfish   390 TSQGMDNCESLCCGRGHNILQQTRSERCNCKFHWCCYVVCEECRITEWVSVCK 442
            .|.|:::|..||||||:|......:|||||||||||.|.||.|........||
  Fly   952 NSSGLESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVKCEVCTKVLEEHTCK 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wnt10aNP_571055.1 wnt 104..442 CDD:278536 128/494 (26%)
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 128/494 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586749
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.