DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2BC5 and His2B:CG33884

DIOPT Version :10

Sequence 1:NP_066407.1 Gene:H2BC5 / 3017 HGNCID:4747 Length:126 Species:Homo sapiens
Sequence 2:NP_001027345.1 Gene:His2B:CG33884 / 3772575 FlyBaseID:FBgn0053884 Length:123 Species:Drosophila melanogaster


Alignment Length:129 Identity:103/129 - (79%)
Similarity:107/129 - (82%) Gaps:9/129 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     1 MPEPTKSAPAPKKGSKKAVTKAQK---KDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGI 62
            ||..|....|.|.|      ||||   |..||:||.|||||::|:||||||||||||||||||.|
  Fly     1 MPPKTSGKAAKKAG------KAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSI 59

Human    63 MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126
            |||||||||||||.||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    60 MNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2BC5NP_066407.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 16/37 (43%)
HFD_H2B 30..123 CDD:467035 85/92 (92%)
His2B:CG33884NP_001027345.1 HFD_H2B 33..120 CDD:467035 81/86 (94%)

Return to query results.
Submit another query.