DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neurod1 and dimm

DIOPT Version :9

Sequence 1:NP_571053.1 Gene:neurod1 / 30169 ZFINID:ZDB-GENE-990415-172 Length:350 Species:Danio rerio
Sequence 2:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster


Alignment Length:356 Identity:82/356 - (23%)
Similarity:125/356 - (35%) Gaps:122/356 - (34%)


- Green bases have known domain annotations that are detailed below.


Zfish    11 MLESQSSSNWTDKCHSSSQDERDVDKTSEPMLNDMEDDDDAGLNRLED-----------EDDEEE 64
            |.:|.|.|:.|.....||........|..|....:.....:|..|::.           .:....
  Fly    68 MTDSSSQSDDTSGGGGSSNGGGSTTNTGHPSGCSLGGQGPSGRGRVQQASSGACPSTIAPNSTSS 132

Zfish    65 EEEEEDGDDTKPKRRGPKKKKMTKARMQRFKMRRMKANARERNRMHGLNDALESLRKVVPCYSKT 129
            .....:|:.:: :|:|....|      :| .|||:::|.|||.|||.||||.:|||:|:|.....
  Fly   133 NSSNANGNASR-RRKGALNAK------ER-NMRRLESNERERMRMHSLNDAFQSLREVIPHVEME 189

Zfish   130 QKLSKIETLRLAKNYIWALSEILRSGKSPDLMSFVQALCKGLSQPTTNLVAGCLQLNPRTFLPEQ 194
            ::|||||||.||||||..|:.|:.|.::.:                    |..|:||        
  Fly   190 RRLSKIETLTLAKNYIINLTHIILSKRNEE--------------------AAALELN-------- 226

Zfish   195 SQEMPPHMQTASASFSALPYSYQTPGLPSPPYGTMDSSHIFHVKPHAYGSALEPFFDTTLTDCTS 259
                                                        ..|.|..|       |::.:|
  Fly   227 --------------------------------------------SGAVGGVL-------LSNLSS 240

Zfish   260 PSFDGPLSPPLSVNGNFSFKHEPSSEFEKNYAFTMHYQAAGLAGAQGHAASLYAGSTQRCDIPME 324
            .| .||::..:..|.|.:     :..||...|....:..|.||...|   ||...:|......|:
  Fly   241 ES-GGPVASGIPANSNAA-----TICFEDTLASGGAFDCAILAATDG---SLLNAATVTTSPAMQ 296

Zfish   325 NIMSYDGH---------------SHHERVMN 340
            :|.|...|               .||::.|:
  Fly   297 SIQSQAIHLQTPMEQQQQQASHLPHHQQAMH 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neurod1NP_571053.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91 15/90 (17%)
Nuclear localization signal. /evidence=ECO:0000255 82..88 1/5 (20%)
HLH 95..153 CDD:238036 34/57 (60%)
Neuro_bHLH 155..277 CDD:289310 14/121 (12%)
dimmNP_001260674.1 HLH 154..208 CDD:238036 33/54 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.