Sequence 1: | NP_571053.1 | Gene: | neurod1 / 30169 | ZFINID: | ZDB-GENE-990415-172 | Length: | 350 | Species: | Danio rerio |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262334.1 | Gene: | Fer1 / 2768661 | FlyBaseID: | FBgn0037475 | Length: | 256 | Species: | Drosophila melanogaster |
Alignment Length: | 267 | Identity: | 70/267 - (26%) |
---|---|---|---|
Similarity: | 103/267 - (38%) | Gaps: | 93/267 - (34%) |
- Green bases have known domain annotations that are detailed below.
Zfish 1 MTKSYSEESMMLESQSSSN---WTDKCHSSSQDERDVDKTSEPMLNDMEDDDDA---GLNRLEDE 59
Zfish 60 DDEEEEEEEEDGDDTKPKRRGPKKKKMTKARMQRFKMRRMKANARERNRMHGLNDALESLRKVVP 124
Zfish 125 CYSKTQKLSKIETLRLAKNYIWALSEIL---RSGKSPDL-------------------------- 160
Zfish 161 MSFVQALCKGLSQPTTNLVAGCLQLNPRTFLPEQSQEMPPHMQTASASFSALPYSYQTPGLPSPP 225
Zfish 226 YGTMDSS 232 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
neurod1 | NP_571053.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..91 | 23/95 (24%) | |
Nuclear localization signal. /evidence=ECO:0000255 | 82..88 | 1/5 (20%) | |||
HLH | 95..153 | CDD:238036 | 26/60 (43%) | ||
Neuro_bHLH | 155..277 | CDD:289310 | 20/104 (19%) | ||
Fer1 | NP_001262334.1 | HLH | 92..144 | CDD:197674 | 24/51 (47%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |