DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neurod1 and Fer1

DIOPT Version :9

Sequence 1:NP_571053.1 Gene:neurod1 / 30169 ZFINID:ZDB-GENE-990415-172 Length:350 Species:Danio rerio
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:267 Identity:70/267 - (26%)
Similarity:103/267 - (38%) Gaps:93/267 - (34%)


- Green bases have known domain annotations that are detailed below.


Zfish     1 MTKSYSEESMMLESQSSSN---WTDKCHSSSQDERDVDKTSEPMLNDMEDDDDA---GLNRLEDE 59
            |.:.:.|.|....:.:||:   :.|: |||..|                |:|||   |.|     
  Fly    13 MARHFFEGSQATNASTSSSDYFFGDE-HSSESD----------------DEDDAYSSGFN----- 55

Zfish    60 DDEEEEEEEEDGDDTKPKRRGPKKKKMTKARMQRFKMRRMKANARERNRMHGLNDALESLRKVVP 124
            .|:|..|:     ...|..|...|.:..|...| ...:|..||.|||.||..:|:|.|.||..:|
  Fly    56 SDQENTEK-----TFCPFSRRSHKPRRLKCASQ-MAQQRQAANLRERRRMQSINEAFEGLRTHIP 114

Zfish   125 CYSKTQKLSKIETLRLAKNYIWALSEIL---RSGKSPDL-------------------------- 160
            .....::|||::||:||.:||..|||::   ::|..|.|                          
  Fly   115 TLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSLQRNYQKEPPKKIILKDRTGGVAHS 179

Zfish   161 MSFVQALCKGLSQPTTNLVAGCLQLNPRTFLPEQSQEMPPHMQTASASFSALPYSYQTPGLPSPP 225
            :|:.:   ||...|.:.|.|       ||:.||..:  .||.|                  |.|.
  Fly   180 LSWYR---KGDRYPGSKLYA-------RTWTPEDPR--GPHSQ------------------PLPL 214

Zfish   226 YGTMDSS 232
            |...:|:
  Fly   215 YNNSNSN 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neurod1NP_571053.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91 23/95 (24%)
Nuclear localization signal. /evidence=ECO:0000255 82..88 1/5 (20%)
HLH 95..153 CDD:238036 26/60 (43%)
Neuro_bHLH 155..277 CDD:289310 20/104 (19%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.