DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Il18r1 and CG45263

DIOPT Version :9

Sequence 1:NP_001100375.1 Gene:Il18r1 / 301365 RGDID:1308589 Length:537 Species:Rattus norvegicus
Sequence 2:NP_731246.2 Gene:CG45263 / 50003 FlyBaseID:FBgn0266801 Length:1876 Species:Drosophila melanogaster


Alignment Length:404 Identity:81/404 - (20%)
Similarity:138/404 - (34%) Gaps:125/404 - (30%)


- Green bases have known domain annotations that are detailed below.


  Rat     2 HHE----ELILILCVLVVKSAPK-SCIRRSQIHVVEGEPFYLKPCDMSAPMHNNETATMRWFKGN 61
            :||    :.:::...|.||.||. ..|...:|.:.|.:...:..|...|    |..|::.|.:..
  Fly   264 YHESYTAKSVVVEARLDVKYAPSIRLIGSPEIDLEEDKDALVLRCVADA----NPPASIVWRRAG 324

  Rat    62 ASHGYRELNMRSSPRIAFHGHALEFWPVELEDKGTYFSQVGNDRQNWTLNVTKRNKHSCFSEKLV 126
            .|            .||.....|:..||...|.|.|..|..|....              ||:|.
  Fly   325 RS------------EIASLQETLQLRPVGRRDAGLYTCQAQNSVGT--------------SEQLS 363

  Rat   127 TNRDVEVKKSL--------------------------------WITCENPSYGELINHTLLYKNC 159
            ...||:....:                                |:  :..::|.        |..
  Fly   364 VQLDVKYPPKIISAGPDRLTTAPLFSPAAFECLADGNPLPSFKWV--QRMAHGS--------KYV 418

  Rat   160 KEISKTPMILKDAEFGDEGYYSCVFSVHHNGQQ-YNITKTVNITVIEGNS--KITPAIFGSKSAK 221
            :..|::.:::.:..:..:|.|.|..:.:.|||: ..|:..|::.|:....  ::.|::.     .
  Fly   419 ERGSESRLVIDNVTYEYQGEYECRATSYINGQERVAISDPVSLQVVGAPQVLRLHPSLH-----T 478

  Rat   222 VGVELGEDVELN---CSAVLNRNDLFYW-SIRKE----------DSLDPNVHEDRNETTWTFEGK 272
            |.|:.||...|.   |:....:...:.| |:|.|          |.:.|:..||...:|...   
  Fly   479 VSVKRGEAASLTMVVCADPRPQRVAWEWGSLRLEAGSGIDRFRADDMQPDTREDCYLSTLHI--- 540

  Rat   273 LHASKILRIQKVTEKYLNVLYNCTVANEEATDTKSFILVRKETPDIQGHVFMRGITMVVLTSVAA 337
            |||          :::.:..|...|.||..||..:..|:      ::| .|.....|..|..||.
  Fly   541 LHA----------DEHDSRPYYLVVENERGTDRHAIHLI------VEG-TFAEPYEMSYLMGVAG 588

  Rat   338 VC------VVILCI 345
            .|      :|.|||
  Fly   589 GCMAAILLLVCLCI 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Il18r1NP_001100375.1 Ig_2 22..112 CDD:290606 19/89 (21%)
Ig <156..205 CDD:299845 11/49 (22%)
IG_like 224..310 CDD:214653 23/99 (23%)
TIR 370..519 CDD:214587
CG45263NP_731246.2 I-set 53..149 CDD:254352
Ig 198..281 CDD:299845 3/16 (19%)
IG_like 302..368 CDD:214653 19/95 (20%)
IGc2 302..357 CDD:197706 16/70 (23%)
Ig 372..446 CDD:299845 7/83 (8%)
Ig 475..568 CDD:299845 24/110 (22%)
IG_like 478..570 CDD:214653 25/110 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.