DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnt1 and Wnt10

DIOPT Version :9

Sequence 1:XP_005162280.1 Gene:wnt1 / 30128 ZFINID:ZDB-GENE-980526-526 Length:375 Species:Danio rerio
Sequence 2:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster


Alignment Length:470 Identity:148/470 - (31%)
Similarity:206/470 - (43%) Gaps:137/470 - (29%)


- Green bases have known domain annotations that are detailed below.


Zfish    28 GTGAVNNSGRWWGIVNVASSGNLLTNSK-----NVQLVLDPSLALLSR------RQRKLIRQNPG 81
            |:.:.:||          ||.||:....     |:.|::...||..:|      ..|...|..||
  Fly    27 GSSSSSNS----------SSNNLVATPATSRHCNLHLIVMIILACCTRWLYGLPDGRATCRSVPG 81

Zfish    82 --------------ILHAIAAGLHTAIKECKWQFRNRRWNCPT----THSPNVFGKIVNRGCRET 128
                          :..|...||..||:||:.||:..||||.:    :.:|:. ..::.:|.||:
  Fly    82 LTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHA-SSLLKKGYRES 145

Zfish   129 AFVFAITSAGVTHAVARSCSEGAIESCTCD----------------------------------- 158
            ||.|||::|||.|:|||:||:|.:.||.||                                   
  Fly   146 AFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTP 210

Zfish   159 -----YRRRGPGGPDWHWGGCSDNVEFGRMFGREFVDSSERGRDLRYLTNLHNNEAGRMTVASEM 218
                 | .|......|.|||||.|::||..:.:.|:|..|:..|::...|||||.|||:.|::.|
  Fly   211 EEEKKY-ERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHAGRIAVSNNM 274

Zfish   219 QQECKCHGMSGSCTVRTCWMRLPSFRLVGDYLKDRF------------DGASRVVY-------AN 264
            :..||||||||||.::|||...|.|.:||..||.:|            :|...||.       :|
  Fly   275 EFRCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNKKSN 339

Zfish   265 KGSNRASHRAD--------------------PRHLE------PENP---------AHKLPSSRDL 294
            .||...|...|                    .||.|      ...|         |.||.:|  |
  Fly   340 GGSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAARMARKLETS--L 402

Zfish   295 VYFEKSPNFCSYNGKTGTHGTSGRTCNSSSPALDGCELLCCGRGYKTRMEQVTERCHCTFHWCCH 359
            .|:::|||||..:......||.||.||.::...|||..||||||:...:::..|||||.|.|||:
  Fly   403 FYYQRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAERCHCKFQWCCN 467

Zfish   360 VSCLNCTSTQTVHQC 374
            |.|..|...:.:..|
  Fly   468 VECEECHVEEWISIC 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wnt1XP_005162280.1 WNT1 64..375 CDD:128408 139/429 (32%)
Wnt10NP_609109.3 wnt 82..466 CDD:278536 126/387 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.