DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnt2 and Wnt10

DIOPT Version :9

Sequence 1:NP_571025.1 Gene:wnt2 / 30127 ZFINID:ZDB-GENE-980526-416 Length:350 Species:Danio rerio
Sequence 2:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster


Alignment Length:422 Identity:131/422 - (31%)
Similarity:193/422 - (45%) Gaps:107/422 - (25%)


- Green bases have known domain annotations that are detailed below.


Zfish    28 WYMGTLGSQVMCDNIPGLINKQRQLCRQHPKVMQAIGAGIKNWIGECQHQFRTHRWNCNTMARE- 91
            |..|....:..|.::|||...|.:||.:...|..|...|:...|.|||.||:.|||||::::.: 
  Fly    65 WLYGLPDGRATCRSVPGLTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKS 129

Zfish    92 ---HNLFGRLLHRSSREAAFVYAISSAGMVYTLTRACSQGELENCSCDP--GKKGSSRDAKGAFD 151
               |  ...||.:..||:||.:|||:||:.:::.||||||.|.:|.|||  .:|..:::.:.:.|
  Fly   130 RNPH--ASSLLKKGYRESAFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLD 192

Zfish   152 ----------------------------------WGGCSDHVDHAIKFTQVFIDAKERKERDARA 182
                                              |||||.::|..::::::|:|.:| |..|.::
  Fly   193 KEKKQFLQYLETNQILTPEEEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCRE-KAGDIQS 256

Zfish   183 LMNLHNNRAGRKAVKRFMNLECKCHGVSGSCNVRTCWLAMADFRQTGDYLRKKYNNAIQVVMNQY 247
            .:|||||.|||.||...|...|||||:||||.::|||.:..||...|..|:.::..||.|..:..
  Fly   257 KINLHNNHAGRIAVSNNMEFRCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNL 321

Zfish   248 ---------------------GTGFTS-------------------------------------- 253
                                 |:|.||                                      
  Fly   322 GNGEPVVVLKRARNKKSNGGSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPS 386

Zfish   254 ----AYRMLKRPNKNDLVYFEDSPDYCIWDHESGSVGTGGRVCNRTSRGTDSCEVMCCGRGYDTS 314
                |.|| .|..:..|.|::.||::|..|..:...||.||.|||.:..:|.|..:|||||:...
  Fly   387 ADKNAARM-ARKLETSLFYYQRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQV 450

Zfish   315 RVSRTTKCECKFQWCCAVHCRDCQEEVDVHTC 346
            ...|..:|.|||||||.|.|.:|..|..:..|
  Fly   451 IQRRAERCHCKFQWCCNVECEECHVEEWISIC 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wnt2NP_571025.1 wnt 45..347 CDD:278536 126/405 (31%)
Wnt10NP_609109.3 wnt 82..466 CDD:278536 119/387 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586762
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.