DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnt2 and Wnt6

DIOPT Version :9

Sequence 1:NP_571025.1 Gene:wnt2 / 30127 ZFINID:ZDB-GENE-980526-416 Length:350 Species:Danio rerio
Sequence 2:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster


Alignment Length:416 Identity:140/416 - (33%)
Similarity:201/416 - (48%) Gaps:86/416 - (20%)


- Green bases have known domain annotations that are detailed below.


Zfish    14 VAICWFSSRVDASWWYMGT---LGSQVMCDNIPGLINKQRQLCRQHPKVM-QAIGAGIKNWIGEC 74
            :||..|:..:....|..||   |...:||.....|..|..::||....:: :.|..||.....||
  Fly     7 IAILIFAMPMTGFGWAEGTNILLDPNLMCKKTRRLRGKLAEICRHDSALLKEIIINGINLGFREC 71

Zfish    75 QHQFRTHRWNCNTMAREHNLFGRLLHRSSREAAFVYAISSAGMVYTLTRACSQGELENCSCD--- 136
            :.|||..||||..:.:.   ..::|.|.|||..||.||::||:.|.:|:||:.|:|..||||   
  Fly    72 EFQFRNRRWNCTVLRKS---MRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVECSCDKAH 133

Zfish   137 ----------------------------------------------------------------- 136
                                                                             
  Fly   134 MRRNGGQPQMVTAATAEAALERQQQAAMLRQQMPLQDQHPSQRLSRMNNASTMTDIAPVEHRGGR 198

Zfish   137 ---PGKKGSSRD-------AKGAFDWGGCSDHVDHAIKFTQVFIDAKERKER-DARALMNLHNNR 190
               ||.:...|.       .:|.::||||||:|:..::.::||:|||:|:.| |...|:..|||.
  Fly   199 NRRPGGRRGRRKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGTLVKFHNNN 263

Zfish   191 AGRKAVKRFMNLECKCHGVSGSCNVRTCWLAMADFRQTGDYLRKKYNNAIQVVMNQYGTGFTSAY 255
            |||.|::..|.|||||||:||||.|:||||.|..||:....||.:|::|.:|.:...|..|....
  Fly   264 AGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTLRNDGNSFMPES 328

Zfish   256 RMLKRPNKNDLVYFEDSPDYCIWDHESGSVGTGGRVCNRTSRGTDSCEVMCCGRGYDTSRVSRTT 320
            ...:..||..||:.:||||:|..:.::|::||.||.||.||.|:|.|:.:||.||:....|...|
  Fly   329 PHARPANKYQLVFADDSPDFCTPNSKTGALGTQGRECNVTSSGSDRCDRLCCNRGHTRRIVEEQT 393

Zfish   321 KCECKFQWCCAVHCRDCQEEVDVHTC 346
            .|:|.|:|||.|.|..|.|...|:||
  Fly   394 NCKCVFKWCCEVTCEKCLEHRAVNTC 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wnt2NP_571025.1 wnt 45..347 CDD:278536 131/382 (34%)
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 129/380 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.