DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnt2 and Wnt5

DIOPT Version :9

Sequence 1:NP_571025.1 Gene:wnt2 / 30127 ZFINID:ZDB-GENE-980526-416 Length:350 Species:Danio rerio
Sequence 2:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster


Alignment Length:467 Identity:133/467 - (28%)
Similarity:195/467 - (41%) Gaps:168/467 - (35%)


- Green bases have known domain annotations that are detailed below.


Zfish    39 CDNIPGLINKQRQLCRQHPKVMQAIGAGIKNWIGECQHQFRTHRWNCNTMAREHNLFGRLLHRSS 103
            |.:..||.|.|::.|.:|..||.||..|.:..|.|||.||:..||||:| ..:..:||.:...::
  Fly   548 CYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCST-TNDETVFGPMTSLAA 611

Zfish   104 REAAFVYAISSAGMVYTLTRACSQGELENCSCDPGKKGSSRDAKGAFDWGGCSDHVDHAIKFTQV 168
            .|.||::|:::|.:...:.|||..|:|.:|||..|.:  .:.....:.||||.|:::.|.||...
  Fly   612 PEMAFIHALAAATVTSFIARACRDGQLASCSCSRGSR--PKQLHDDWKWGGCGDNLEFAYKFATD 674

Zfish   169 FIDAKE----------------------------------------------------------- 174
            |||::|                                                           
  Fly   675 FIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRKSTEA 739

Zfish   175 -----------------------------------------------------------RKER-- 178
                                                                       :|:|  
  Fly   740 ENSHILNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKKKRKN 804

Zfish   179 --------------------------------DARALMNLHNNRAGRKAVKRFMNLECKCHGVSG 211
                                            .||:|||||||.|||:||.:...:.||||||||
  Fly   805 QRAAADAPAYPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEAGRRAVIKKARITCKCHGVSG 869

Zfish   212 SCNVRTCWLAMADFRQTGDYLRKKYNNAIQVVMNQYGTGFTSAYRM------LKRPNKNDLVYFE 270
            ||::.|||..::..|:.|||||:||..|.:|.:|:.|       |:      .|.|..:||:|.:
  Fly   870 SCSLITCWQQLSSIREIGDYLREKYEGATKVKINKRG-------RLQIKDLQFKVPTAHDLIYLD 927

Zfish   271 DSPDYCIWDHESGSVGTGGRVCNRTSRGTDSCEVMCCGRGYDTSRVSRTTKCECKFQWCCAVHCR 335
            :|||:|...:.....||.||||::.|.|.:||.::||||||:|..:....:|.|||.|||.|.|.
  Fly   928 ESPDWCRNSYALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVKCE 992

Zfish   336 DCQEEVDVHTCK 347
            .|.:.::.||||
  Fly   993 VCTKVLEEHTCK 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wnt2NP_571025.1 wnt 45..347 CDD:278536 129/459 (28%)
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 129/459 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586761
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326151at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X108
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.