DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnt4 and wntD

DIOPT Version :9

Sequence 1:NP_001035477.1 Gene:wnt4 / 30123 ZFINID:ZDB-GENE-980526-352 Length:352 Species:Danio rerio
Sequence 2:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster


Alignment Length:309 Identity:79/309 - (25%)
Similarity:130/309 - (42%) Gaps:60/309 - (19%)


- Green bases have known domain annotations that are detailed below.


Zfish    65 DAVRRGAQLAIDECQYQFRNRRWNCSTLESVPVFGKVVTQG-TREAAFVYAISAASVAFAVTRAC 128
            |...:|.:.|:|.||..|:.:||||.:.:.|....|..... .||..:|.|||.|::...:|:.|
  Fly    38 DITGKGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDC 102

Zfish   129 SSGELDKCGCDRNVHGVSPEGFQWSGCSDNIAYGVAFSQSFVDIRERSKGQSSNRALMNLHNNEA 193
            ::|.:..|||..|...|.        |:..       ....::..|:..|..|...   .||...
  Fly   103 ANGVIAGCGCTENALNVP--------CAHE-------PTKALEQYEKHFGSGSGAI---GHNRRV 149

Zfish   194 GRKAILNHMRVECKCH---GVSGSCEVKTCWKAMPPFRKVGNVIKEKFDGATEVELRKVGTTKVL 255
            ....:...:..||:|.   .|.|.|:.:.|...:.||..:...:.:.:|.|.::|    |.:..|
  Fly   150 VGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQLE----GASSNL 210

Zfish   256 ------VPRNSQFKPHTDEDLVYLDPSPDFCEHDPRTPGI-MGTAGRFCNKTSKAIDG------- 306
                  :|.:|         ||::..||::||.|  ..|: .||.||.|:|     ||       
  Fly   211 KIMWQNIPLDS---------LVFMQDSPNYCERD--ATGLWKGTRGRQCSK-----DGSGSLEER 259

Zfish   307 --CELMC--CGRGFHTEEVEVVDRCSCKFHWCCYVKCKQCRKMVEMHTC 351
              |:.:|  ||....::.|....||:||..|...::|..|.::...::|
  Fly   260 LSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wnt4NP_001035477.1 WNT1 45..352 CDD:128408 79/309 (26%)
wntDNP_650272.1 wnt 41..308 CDD:302926 77/304 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.