DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnt8a and Wnt10

DIOPT Version :9

Sequence 1:NP_571021.3 Gene:wnt8a / 30122 ZFINID:ZDB-GENE-980526-332 Length:359 Species:Danio rerio
Sequence 2:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster


Alignment Length:438 Identity:133/438 - (30%)
Similarity:185/438 - (42%) Gaps:139/438 - (31%)


- Green bases have known domain annotations that are detailed below.


Zfish    10 LVMSICCHILSSTAW------------SVNNFLMTGPKAYLAY-TSSVQAGAQSG----IEECKH 57
            :::..||     |.|            ||..  :|..:..|.| .|.|.|.|..|    |.||:.
  Fly    56 MIILACC-----TRWLYGLPDGRATCRSVPG--LTKDQVELCYKASDVTAAALEGLDMAIRECQI 113

Zfish    58 QFAWDRWNCPE-SALQLSTHKG--LRSATRETAFVHAISAAGVMYTLTKNCSMGDFENCGCDDS- 118
            ||.|.||||.. |....:.|..  |:...||:||..|||||||.:::.:.||.|...:||||.: 
  Fly   114 QFQWHRWNCSSLSTKSRNPHASSLLKKGYRESAFAFAISAAGVAHSVARACSQGRLMSCGCDPTI 178

Zfish   119 --------------------------------------KIGKMGGRGWVWGGCSDNVNFGDRIAK 145
                                                  :..|:..| |.|||||.|::||...:|
  Fly   179 NRKTLNKNLRQSLDKEKKQFLQYLETNQILTPEEEKKYERSKIASR-WKWGGCSHNMDFGVEYSK 242

Zfish   146 LFVDALENGHDSRAAVNLHNNEAGRLAVKATLKRTCKCHGLSGSCSIQTCWMQLADFRDIGSYLK 210
            ||:|..|...|.::.:|||||.|||:||...::..|||||:||||.::|||....||..:|..| 
  Fly   243 LFLDCREKAGDIQSKINLHNNHAGRIAVSNNMEFRCKCHGMSGSCQLKTCWKSAPDFHIVGKVL- 306

Zfish   211 IKHDQARKLEMDK----------IRMRAGNSADNRGA---------------------------- 237
             ||...:.:.:|:          :..||.|...|.|:                            
  Fly   307 -KHQFRKAILVDQSNLGNGEPVVVLKRARNKKSNGGSGSGSTSPDLDSTDASGGHDDGGTGDSET 370

Zfish   238 ---------------IADTFSA-VAR---TELIFMEDSPDYCVKNLSMGLHGTEGRECLQSGKNL 283
                           .||..:| :||   |.|.:.:.||::|.::|...:.||.||:|     |.
  Fly   371 RRHDELGVERGTRQPSADKNAARMARKLETSLFYYQRSPNFCERDLGADIQGTVGRKC-----NR 430

Zfish   284 SQWERRSCRRLCHECG---LKVEERRIETVSSCNCKFHWCCTVKCETC 328
            :......|..||  ||   .:|.:||.|   .|:|||.|||.|:||.|
  Fly   431 NTTTSDGCTSLC--CGRGHSQVIQRRAE---RCHCKFQWCCNVECEEC 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wnt8aNP_571021.3 WNT1 22..337 CDD:128408 131/426 (31%)
Wnt10NP_609109.3 wnt 82..466 CDD:278536 121/396 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586717
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.