DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wnt8a and Wnt6

DIOPT Version :9

Sequence 1:NP_571021.3 Gene:wnt8a / 30122 ZFINID:ZDB-GENE-980526-332 Length:359 Species:Danio rerio
Sequence 2:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster


Alignment Length:366 Identity:121/366 - (33%)
Similarity:166/366 - (45%) Gaps:98/366 - (26%)


- Green bases have known domain annotations that are detailed below.


Zfish    47 GAQSGIEECKHQFAWDRWNCPESALQLSTHKGLRSATRETAFVHAISAAGVMYTLTKNCSMGDFE 111
            |...|..||:.||...||||  :.|:.|..|.|...:|||.||:||:||||.|.:||.|:||...
  Fly    63 GINLGFRECEFQFRNRRWNC--TVLRKSMRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLV 125

Zfish   112 NCGCDDSKIGKMGG--------------------------------------------------- 125
            .|.||.:.:.:.||                                                   
  Fly   126 ECSCDKAHMRRNGGQPQMVTAATAEAALERQQQAAMLRQQMPLQDQHPSQRLSRMNNASTMTDIA 190

Zfish   126 ---------------RG--------------WVWGGCSDNVNFGDRIAKLFVDALENGH--DSRA 159
                           ||              |.|||||||||||.|.:::|:||.:...  |...
  Fly   191 PVEHRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGT 255

Zfish   160 AVNLHNNEAGRLAVKATLKRTCKCHGLSGSCSIQTCWMQLADFRDIGSYLKIKHDQARKLEMDKI 224
            .|..|||.|||||::..::..||||||||||:::|||:::..||::...|:.::|.|||:.:   
  Fly   256 LVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTL--- 317

Zfish   225 RMRAGNSADNRGAIADTFSAVARTELIFMEDSPDYCVKNLSMGLHGTEGRECLQSGKNLSQWERR 289
             ...|||.......|   ....:.:|:|.:||||:|..|...|..||:||||     |::.....
  Fly   318 -RNDGNSFMPESPHA---RPANKYQLVFADDSPDFCTPNSKTGALGTQGREC-----NVTSSGSD 373

Zfish   290 SCRRLCHECGLKVEERRIETVSSCNCKFHWCCTVKCETCTQ 330
            .|.|||  |......|.:|..::|.|.|.|||.|.||.|.:
  Fly   374 RCDRLC--CNRGHTRRIVEEQTNCKCVFKWCCEVTCEKCLE 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wnt8aNP_571021.3 WNT1 22..337 CDD:128408 121/366 (33%)
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 121/366 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.