DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment flt4 and Cad96Ca

DIOPT Version :9

Sequence 1:NP_571020.2 Gene:flt4 / 30121 ZFINID:ZDB-GENE-980526-326 Length:1368 Species:Danio rerio
Sequence 2:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster


Alignment Length:488 Identity:144/488 - (29%)
Similarity:223/488 - (45%) Gaps:130/488 - (26%)


- Green bases have known domain annotations that are detailed below.


Zfish   780 SSATVSVIGSDDKTNVEIVILIGTGVIAIFFWVLLLVIFCN-------------------VKRVN 825
            ||:.:::......| :.||:.:|...:||   .:||...|.                   .|:.|
  Fly   302 SSSPITIFSLKSGT-IPIVVTVGGFFVAI---AVLLAYLCRRRLCAISRTLKKTKEKEELAKKSN 362

Zfish   826 PADIKTGYL-----SIIMDPGEVPLEEQCEYLPYDSSQ--------------------------- 858
            .:.:.:...     |::|...:.|:.....|:|::..|                           
  Fly   363 QSQLSSTLTDDSRNSMVMQQWQGPVAFANRYVPWERDQQMGIATSQLSTGVTNGGVSSPGVPSPG 427

Zfish   859 -----------------------------------WEISRDRLRLGKVLGHGAFGKVIEASIFGH 888
                                               ||..|.||:...:||.||||:|........
  Fly   428 TGEPGSNLGPGCLTGGAGSSGAPENAFAGEANCDRWEFPRYRLKFFNILGEGAFGQVWRCEATNI 492

Zfish   889 DKKSSANTVAVKMLKEGATASEHKALMSELKILIHIGNHLNVVNLLGACTKPNGPLMVIVEYCKY 953
            :......|||||.|||.||..:.|.|:|||:::..:..|:|||:|||.||..: |..||:||...
  Fly   493 NGNEGITTVAVKTLKESATEVDRKDLLSELEVMKSLEPHINVVHLLGCCTDKD-PTFVILEYVNR 556

Zfish   954 GNLSNFLRAKREFFLPYRDRSPKTQSQVRRMIEAGQASQSEHQPSTSSTNPPRVTVDDLWKTPLT 1018
            |.|..:||:.|                           ...|..:|...:           ..||
  Fly   557 GKLQTYLRSSR---------------------------AERHYGNTHGKS-----------NVLT 583

Zfish  1019 IEDLICYSFQVARGMEFLASRKCIHRDLAARNILLSENNVVKICDFGLARDIYKDPDYVRKGNAR 1083
            ..||..:.:|||:||::|.||..|||||||||||:::::..|:.|||.|||:.....|.||...:
  Fly   584 SCDLTSFMYQVAKGMDYLTSRGIIHRDLAARNILITDDHTCKVADFGFARDVITSKIYERKSEGK 648

Zfish  1084 LPLKWMAPESIFDKVYTSQSDVWSFGVLLWEIFSLGASPYPGIQIDEDFCKRLKDGTRMRAPDNA 1148
            ||::|||.||::|.:::.:||:||||:|:|||.:||::|||||.. .|..::::||.|:..|::.
  Fly   649 LPIRWMATESLYDNIFSVKSDIWSFGILMWEIVTLGSTPYPGISA-ADVMRKVRDGYRLEKPEHC 712

Zfish  1149 SPEIYGIMLACWQGEPRERPTFPALVEILGDLL 1181
            ..|:|.||..||..:|:|||.|..::::|..||
  Fly   713 RRELYNIMYYCWSHDPQERPLFAEIIQMLDKLL 745

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
flt4NP_571020.2 IG_like 258..348 CDD:214653
Ig1_VEGFR 265..350 CDD:143270
IG_like 362..445 CDD:214653
Ig 373..445 CDD:299845
Ig 602..685 CDD:143165
IG 602..678 CDD:214652
I-set 705..786 CDD:254352 2/5 (40%)
IGc2 714..776 CDD:197706
PKc_like 858..1184 CDD:304357 126/386 (33%)
Pkinase_Tyr 866..1177 CDD:285015 118/310 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 978..1007 2/28 (7%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1190..1212
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568 118/310 (38%)
PTKc 474..742 CDD:270623 117/307 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.