DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frzb and fz

DIOPT Version :9

Sequence 1:NP_571018.1 Gene:frzb / 30119 ZFINID:ZDB-GENE-990715-1 Length:315 Species:Danio rerio
Sequence 2:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster


Alignment Length:116 Identity:55/116 - (47%)
Similarity:76/116 - (65%) Gaps:4/116 - (3%)


- Green bases have known domain annotations that are detailed below.


Zfish    31 CEPIRIPMCKSMPWNMTKMPNHLHHSTQANAVLAIEQFEGLLGTQCSADLLFFLCAMYAPICTID 95
            ||||.|.:||::|:|||.|||.:.|:.|..|.|.:.||..|:...||.||..|||::|.|:||| 
  Fly    53 CEPITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTI- 116

Zfish    96 FQHDPIKPCKSVCERAKCGCEPVMKRYNHTWPESLACEELPVY-DRGVCIS 145
             ...||.||:|:||.|:. ||.:||.||..|||:|.|.:.||: ...:|::
  Fly   117 -LERPIPPCRSLCESARV-CEKLMKTYNFNWPENLECSKFPVHGGEDLCVA 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frzbNP_571018.1 CRD_SFRP3 28..153 CDD:143550 55/116 (47%)
NTR_Sfrp3_like 200..310 CDD:239636
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 55/116 (47%)
Frizzled 237..564 CDD:279827
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.