DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frzb and fz2

DIOPT Version :9

Sequence 1:NP_571018.1 Gene:frzb / 30119 ZFINID:ZDB-GENE-990715-1 Length:315 Species:Danio rerio
Sequence 2:NP_001262037.1 Gene:fz2 / 40090 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster


Alignment Length:134 Identity:60/134 - (44%)
Similarity:82/134 - (61%) Gaps:15/134 - (11%)


- Green bases have known domain annotations that are detailed below.


Zfish    31 CEPIRIPMCKSMPWNMTKMPNHLHHSTQANAVLAIEQFEGLLGTQCSADLLFFLCAMYAPICTID 95
            ||.|.||||:.:.:|||..||.::|.||..|.|.:.||..|:..:||.||.||||:||.|||..|
  Fly    64 CEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLED 128

Zfish    96 FQHDPIKPCKSVCERAKCGCEPVMKRYNHTWPESLACEELPVYDRGVCISPEAIVKAEGPDNSYY 160
            : |.|:..|:||||||:.||.|:|::|:..|||.:|||.||::.              .|||...
  Fly   129 Y-HKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHG--------------DPDNLCM 178

Zfish   161 QDPA 164
            :.|:
  Fly   179 EQPS 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frzbNP_571018.1 CRD_SFRP3 28..153 CDD:143550 56/121 (46%)
NTR_Sfrp3_like 200..310 CDD:239636
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 59/132 (45%)
Frizzled 308..618 CDD:279827
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11309
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.