DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frzb and Corin

DIOPT Version :9

Sequence 1:NP_571018.1 Gene:frzb / 30119 ZFINID:ZDB-GENE-990715-1 Length:315 Species:Danio rerio
Sequence 2:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster


Alignment Length:298 Identity:64/298 - (21%)
Similarity:112/298 - (37%) Gaps:79/298 - (26%)


- Green bases have known domain annotations that are detailed below.


Zfish    30 SCEPIRIPMCK--SMPWNMTKMPNHLHHSTQANAVLAIEQFEGLLGTQCSADLLFFLCAMYAPIC 92
            :|.||.:..|:  .:|:|.|..||::.|..|......::.:|.|:..:|...:..|||.::.|.|
  Fly   778 TCLPIIVRFCQGPQIPYNYTVFPNYIGHFGQLETQTDLDSYEALVDVRCYELVSLFLCTLFVPKC 842

Zfish    93 TIDFQHDPIKPCKSVCERAKCGCEPVMKRYNHTWPESLAC---EELPVYDRGVCISP--EAIVKA 152
              ......:.|||::|......|......:..:.||.|.|   ::.|..:..|.:..  |.:..|
  Fly   843 --GQSGATVPPCKTLCTETMRRCGFFFDVFGLSLPEYLNCKLFKDFPSSEDCVGLDEVREVMRAA 905

Zfish   153 EGPDNSYYQ-DPAKCNPEGNPDFPMDSHNTNCKGANDRCKCKSVKFNQKTYSKNNYNYVIRARVK 216
            ..|....:| |..:|.|:   ::..|.| .:|....|..||:                  |....
  Fly   906 THPKCDGFQCDQNRCLPQ---EYVCDGH-LDCMDQADEAKCE------------------RCGPD 948

Zfish   217 EIRIRNHDLSAIVEVKEVLKSSLVNIPRDTVTLYYNSGCL-CPPLTANDEYIIMGYENEERSRLL 280
            ||...:   |..:..|.:.                 .|.: ||            |..:||:.|.
  Fly   949 EIYCGD---SQCIGTKHIC-----------------DGIIDCP------------YGQDERNCLR 981

Zfish   281 LIDRS------IAQKWKEKIGRK------VKRWDQAAN 306
            |.:|:      :.:.:  :||::      ||.||:|.:
  Fly   982 LSERNGDVGTGVLEVY--RIGQRQWMPACVKNWDRAVS 1017

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frzbNP_571018.1 CRD_SFRP3 28..153 CDD:143550 31/129 (24%)
NTR_Sfrp3_like 200..310 CDD:239636 21/120 (18%)
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549 29/117 (25%)
LDLa 911..942 CDD:238060 8/34 (24%)
LDLa 945..979 CDD:238060 10/65 (15%)
SR 980..>1034 CDD:214555 10/40 (25%)
SRCR 992..1086 CDD:278931 7/28 (25%)
Tryp_SPc 1103..1343 CDD:214473
Tryp_SPc 1104..1346 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.