DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frzb and smo

DIOPT Version :9

Sequence 1:NP_571018.1 Gene:frzb / 30119 ZFINID:ZDB-GENE-990715-1 Length:315 Species:Danio rerio
Sequence 2:NP_523443.1 Gene:smo / 33196 FlyBaseID:FBgn0003444 Length:1036 Species:Drosophila melanogaster


Alignment Length:184 Identity:41/184 - (22%)
Similarity:67/184 - (36%) Gaps:31/184 - (16%)


- Green bases have known domain annotations that are detailed below.


Zfish    12 CVLAFACLLEIPRGTGAASCEPIRIPMCKSMPWNMTKMPNHLHHSTQANAVLAIEQFEGLLGTQC 76
            ||....|   .|......:|...::|. :....::|........:.:.|...|::..     .:|
  Fly    84 CVRRARC---YPTSNATNTCFGSKLPY-ELSSLDLTDFHTEKELNDKLNDYYALKHV-----PKC 139

Zfish    77 SADLLFFLCAMYAPIC-TIDFQHDPIKPCKSVCERAKCGCEPVMKRYNHT-WPESLACEE----- 134
            .|.:..||||::.|.| .|:.:.....|...:|   :...||....||.| :|:.|.|.|     
  Fly   140 WAAIQPFLCAVFKPKCEKINGEDMVYLPSYEMC---RITMEPCRILYNTTFFPKFLRCNETLFPT 201

Zfish   135 --------LPVYDRGVCISPEAIVKAEGPDNSYYQDPAKCNPE-GNPDFPMDSH 179
                    :.....|.|:||  :|..: ...|||.....|... .:|.:..|.|
  Fly   202 KCTNGARGMKFNGTGQCLSP--LVPTD-TSASYYPGIEGCGVRCKDPLYTDDEH 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frzbNP_571018.1 CRD_SFRP3 28..153 CDD:143550 30/139 (22%)
NTR_Sfrp3_like 200..310 CDD:239636
smoNP_523443.1 CRD_SMO 86..221 CDD:143560 29/146 (20%)
Frizzled 246..568 CDD:279827 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.