DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mixl1 and ey

DIOPT Version :9

Sequence 1:NP_571015.3 Gene:mixl1 / 30115 ZFINID:ZDB-GENE-000208-20 Length:327 Species:Danio rerio
Sequence 2:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster


Alignment Length:308 Identity:84/308 - (27%)
Similarity:115/308 - (37%) Gaps:101/308 - (32%)


- Green bases have known domain annotations that are detailed below.


Zfish    46 GASRADNVSLFTHR---RKRTNFTQQQIDVLEKVYLDTKYPDIYLREKLEALTGLPESRIQVWFQ 107
            |.:..|...|...|   |.||:||..|||.|||.:..|.|||::.||:|....||||:||||||.
  Fly   456 GNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFS 520

Zfish   108 NRRAKSRRQVGI----SIPNKTSGNIL------------TPNNL-----LMHQFTTHQNHSGLEN 151
            |||||.||:..:    ..||.|..:..            :||:|     |:.......:.|.:..
  Fly   521 NRRAKWRREEKLRNQRRTPNSTGASATSSSTSATASLTDSPNSLSACSSLLSGSAGGPSVSTING 585

Zfish   152 LQRTSTFTADSFHQQL---INSSEEKISTIKGDIYDPTTIPCMF-SRTQEN-------------- 198
            |...||.:.:.....|   |:|||           .||.||.:. |.|.:|              
  Fly   586 LSSPSTLSTNVNAPTLGAGIDSSE-----------SPTPIPHIRPSCTSDNDNGRQSEDCRRVCS 639

Zfish   199 --PI------KTDHLS------------VVVPR------SYTQQYPKEHEQFTHSANHAKSTMKQ 237
              |:      .|.|:.            .:.||      |:...|...|        |...:|..
  Fly   640 PCPLGVGGHQNTHHIQSNGHAQGHALVPAISPRLNFNSGSFGAMYSNMH--------HTALSMSD 696

Zfish   238 FLVEYDNFPP-----NKTIGPEMKVVIP--PLPSQSNFMMSSSSPKHI 278
               .|....|     :..:||    :.|  |:|.|.:...||..|.|:
  Fly   697 ---SYGAVTPIPSFNHSAVGP----LAPPSPIPQQGDLTPSSLYPCHM 737

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mixl1NP_571015.3 Homeobox 61..114 CDD:278475 32/52 (62%)
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 32/51 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.