DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Znrf4 and HRD1

DIOPT Version :9

Sequence 1:NP_001020049.1 Gene:Znrf4 / 301127 RGDID:1563631 Length:327 Species:Rattus norvegicus
Sequence 2:NP_014630.1 Gene:HRD1 / 854149 SGDID:S000005373 Length:551 Species:Saccharomyces cerevisiae


Alignment Length:259 Identity:53/259 - (20%)
Similarity:87/259 - (33%) Gaps:69/259 - (26%)


- Green bases have known domain annotations that are detailed below.


  Rat   124 EVTVRCDQSARVLLPHGEPCPEPECHPVVAASWALARAL---------ALAASTLFVLR------ 173
            |.||..|||..||....:...:......:...:...:|:         ||..|.|...|      
Yeast   236 ENTVESDQSQPVLNDDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLL 300

  Rat   174 ---------------QLWPWVRGWGSRGTAVKTQTCQKAQVRTFTRLSDLCAICLDDY------- 216
                           .||...|........:.|.|.:  |::......::|.||:|:.       
Yeast   301 KDVVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVE--QLQNSANDDNICIICMDELIHSPNQQ 363

  Rat   217 ---EEGERLKILPCAHAYHCRCIDPWFSRAARRSCPLCKQSV------------ASTHDGSTDGS 266
               .:.::.|.|||.|..|..|:..|..|:  ::||:|:..|            .|..|.:|..:
Yeast   364 TWKNKNKKPKRLPCGHILHLSCLKNWMERS--QTCPICRLPVFDEKGNVVQTTFTSNSDITTQTT 426

  Rat   267 I---GGDEAPLPGHRPPIWAIQARLRSRRLELLARTVPCRRCNSTTSLGMAENVAPSEATPEPS 327
            :   .|......|....:..:..|..|..:    |.||.:..:   :|.|...   |.:||.|:
Yeast   427 VTDSTGIATDQQGFANEVDLLPTRTTSPDI----RIVPTQNID---TLAMRTR---STSTPSPT 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Znrf4NP_001020049.1 Peptidases_S8_S53 31..>93 CDD:299169
zf-RING_2 207..252 CDD:290367 15/54 (28%)
HRD1NP_014630.1 HRD1 5..551 CDD:227568 53/259 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.